SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 188937.MA3015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA3015
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000281
Family HxlR-like 0.066
Further Details:      
 
Weak hits

Sequence:  188937.MA3015
Domain Number - Region: 99-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.051
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3015
Sequence length 263
Comment (Methanosarcina acetivorans)
Sequence
MMIKILQTKSGVTKFQVLIEIAAHQPNVRQKEIAAKIGITPQAVSEYIKELVNDGLIVTE
GRVRYRITKEGVEWVLENAAEMKQYARFVMEDIISHVSTWTAITKEELKEGQQVYLKMKN
GLLYVSSTEKTGASGTVISDAAEGEDVGVTTLKGLIDLENATITICKVPRVERGGSRKVD
LDRLKALSASKPYIAAIGVESLIALRKIGISPNVMFGTNESVIEAAYHGLSSLVVSVDEQ
VSALLSRLETENLEYELVDLTVE
Download sequence
Identical sequences Q8TLM1
gi|20091833|ref|NP_617908.1| 188937.MA3015 WP_011022954.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]