SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA3167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA3167
Domain Number 1 Region: 95-228
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.5e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00086
Further Details:      
 
Domain Number 2 Region: 17-83
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.41e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA3167
Sequence length 231
Comment (Methanosarcina acetivorans)
Sequence
MLCREAIPMKSTIPEKNAIIQRDGETYVIAPRTPGGIVDPATLRKIADVAEKYGAATLKM
TSEQKMAIVGLKEEDIDAAWSDLGMDAGIVTGPFVKGVKFCPGTTFCRKGQQDAVSLGMK
LEARYRGMKLPYMMKMAVSGCPSSCSEPVIKDVGVMGTAKGYILMVGGAAGLKPRLADVV
AKGLSEEEILAAVDRIVEFFKDYGENRKRLGTIIDEIGLEEFKKEVGLWEK
Download sequence
Identical sequences Q8TL73
gi|20091985|ref|NP_618060.1| 188937.MA3167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]