SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 189518.LA1886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189518.LA1886
Domain Number 1 Region: 8-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.29e-16
Family Anti-sigma factor antagonist SpoIIaa 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 189518.LA1886
Sequence length 116
Comment (Leptospira interrogans serovar Lai)
Sequence
MILNEIIISTEKIDNVQVIKLQGSINSFTEKKFREQLSVSIRSGPVILDLEEVSLISSRG
IQALKEMNQLSFTSRNKLVLIHPTESARNSIKMAALNGLFLIAPDEESALKMTMKK
Download sequence
Identical sequences A0A098MYC3 A0A0C5XE88 A0A0E2CTE6 A0A0E2CZF1 A0A0F6H7Z8 A0A0F6HW74 A0A0F6I8R1 A0A0M3TLI5 A0A161QCW2 A0A1N6USW0 A0A1R0JLH6 A0A1V2ZKP1 A0A2H1XDK5 M3E9W7 M5ZWI9 M6GIB6 M6HVW4 M6KW96 N1USQ1 Q72QU6 Q8F502
gi|45657865|ref|YP_001951.1| gi|24214586|ref|NP_712067.1| 189518.LA1886 267671.LIC12012 gi|386073984|ref|YP_005988301.1| NP_712067.1.97817 WP_000602531.1.10054 WP_000602531.1.100607 WP_000602531.1.100943 WP_000602531.1.10099 WP_000602531.1.101113 WP_000602531.1.101360 WP_000602531.1.102083 WP_000602531.1.11367 WP_000602531.1.11416 WP_000602531.1.11890 WP_000602531.1.12132 WP_000602531.1.12257 WP_000602531.1.12296 WP_000602531.1.13846 WP_000602531.1.14057 WP_000602531.1.14181 WP_000602531.1.14552 WP_000602531.1.15012 WP_000602531.1.1506 WP_000602531.1.15739 WP_000602531.1.16487 WP_000602531.1.17129 WP_000602531.1.17260 WP_000602531.1.175 WP_000602531.1.1759 WP_000602531.1.17762 WP_000602531.1.18168 WP_000602531.1.18925 WP_000602531.1.18988 WP_000602531.1.19091 WP_000602531.1.19636 WP_000602531.1.19821 WP_000602531.1.19906 WP_000602531.1.20233 WP_000602531.1.2069 WP_000602531.1.20778 WP_000602531.1.2170 WP_000602531.1.22564 WP_000602531.1.22580 WP_000602531.1.23212 WP_000602531.1.23353 WP_000602531.1.23514 WP_000602531.1.2392 WP_000602531.1.24270 WP_000602531.1.24738 WP_000602531.1.250 WP_000602531.1.25259 WP_000602531.1.25470 WP_000602531.1.25773 WP_000602531.1.26235 WP_000602531.1.26477 WP_000602531.1.26822 WP_000602531.1.27867 WP_000602531.1.28 WP_000602531.1.28517 WP_000602531.1.2987 WP_000602531.1.30744 WP_000602531.1.30921 WP_000602531.1.30957 WP_000602531.1.31178 WP_000602531.1.3128 WP_000602531.1.31321 WP_000602531.1.3175 WP_000602531.1.31926 WP_000602531.1.32453 WP_000602531.1.32692 WP_000602531.1.32859 WP_000602531.1.3288 WP_000602531.1.33670 WP_000602531.1.339 WP_000602531.1.34232 WP_000602531.1.34457 WP_000602531.1.34735 WP_000602531.1.35515 WP_000602531.1.35633 WP_000602531.1.35956 WP_000602531.1.36087 WP_000602531.1.36128 WP_000602531.1.36297 WP_000602531.1.36581 WP_000602531.1.36759 WP_000602531.1.37254 WP_000602531.1.3754 WP_000602531.1.37594 WP_000602531.1.382 WP_000602531.1.38403 WP_000602531.1.3874 WP_000602531.1.39007 WP_000602531.1.39100 WP_000602531.1.39787 WP_000602531.1.39967 WP_000602531.1.40783 WP_000602531.1.41353 WP_000602531.1.41637 WP_000602531.1.42222 WP_000602531.1.42779 WP_000602531.1.4308 WP_000602531.1.43311 WP_000602531.1.43353 WP_000602531.1.43570 WP_000602531.1.44274 WP_000602531.1.44326 WP_000602531.1.45100 WP_000602531.1.45262 WP_000602531.1.45679 WP_000602531.1.4572 WP_000602531.1.46007 WP_000602531.1.46812 WP_000602531.1.46987 WP_000602531.1.46993 WP_000602531.1.47686 WP_000602531.1.47834 WP_000602531.1.48092 WP_000602531.1.48108 WP_000602531.1.48207 WP_000602531.1.48838 WP_000602531.1.49027 WP_000602531.1.49352 WP_000602531.1.50403 WP_000602531.1.50455 WP_000602531.1.50786 WP_000602531.1.50856 WP_000602531.1.50904 WP_000602531.1.51217 WP_000602531.1.51443 WP_000602531.1.51531 WP_000602531.1.5165 WP_000602531.1.51687 WP_000602531.1.51773 WP_000602531.1.52005 WP_000602531.1.52351 WP_000602531.1.53255 WP_000602531.1.53346 WP_000602531.1.53569 WP_000602531.1.5368 WP_000602531.1.5446 WP_000602531.1.54587 WP_000602531.1.55693 WP_000602531.1.55703 WP_000602531.1.55852 WP_000602531.1.56120 WP_000602531.1.56629 WP_000602531.1.5678 WP_000602531.1.56812 WP_000602531.1.58511 WP_000602531.1.58842 WP_000602531.1.59857 WP_000602531.1.60409 WP_000602531.1.60804 WP_000602531.1.6135 WP_000602531.1.61403 WP_000602531.1.61658 WP_000602531.1.6171 WP_000602531.1.61777 WP_000602531.1.62172 WP_000602531.1.62196 WP_000602531.1.62202 WP_000602531.1.63084 WP_000602531.1.63541 WP_000602531.1.63646 WP_000602531.1.63688 WP_000602531.1.64760 WP_000602531.1.64963 WP_000602531.1.65294 WP_000602531.1.65513 WP_000602531.1.65559 WP_000602531.1.65719 WP_000602531.1.6574 WP_000602531.1.66305 WP_000602531.1.668 WP_000602531.1.67052 WP_000602531.1.67243 WP_000602531.1.67344 WP_000602531.1.67411 WP_000602531.1.67421 WP_000602531.1.6761 WP_000602531.1.68135 WP_000602531.1.68799 WP_000602531.1.68993 WP_000602531.1.69136 WP_000602531.1.69218 WP_000602531.1.70155 WP_000602531.1.70516 WP_000602531.1.70913 WP_000602531.1.70921 WP_000602531.1.71080 WP_000602531.1.71461 WP_000602531.1.72166 WP_000602531.1.72187 WP_000602531.1.7280 WP_000602531.1.72830 WP_000602531.1.73036 WP_000602531.1.73107 WP_000602531.1.73302 WP_000602531.1.73583 WP_000602531.1.74258 WP_000602531.1.74515 WP_000602531.1.74558 WP_000602531.1.74792 WP_000602531.1.75054 WP_000602531.1.75316 WP_000602531.1.75377 WP_000602531.1.76063 WP_000602531.1.76404 WP_000602531.1.76740 WP_000602531.1.76970 WP_000602531.1.76971 WP_000602531.1.7707 WP_000602531.1.77178 WP_000602531.1.77242 WP_000602531.1.77874 WP_000602531.1.78069 WP_000602531.1.7821 WP_000602531.1.78364 WP_000602531.1.78551 WP_000602531.1.78739 WP_000602531.1.79237 WP_000602531.1.79939 WP_000602531.1.81113 WP_000602531.1.81443 WP_000602531.1.8167 WP_000602531.1.81803 WP_000602531.1.82080 WP_000602531.1.82375 WP_000602531.1.82393 WP_000602531.1.82978 WP_000602531.1.83052 WP_000602531.1.83201 WP_000602531.1.84222 WP_000602531.1.84376 WP_000602531.1.84406 WP_000602531.1.84450 WP_000602531.1.85034 WP_000602531.1.86863 WP_000602531.1.86894 WP_000602531.1.87123 WP_000602531.1.8721 WP_000602531.1.8748 WP_000602531.1.87797 WP_000602531.1.87860 WP_000602531.1.87965 WP_000602531.1.88006 WP_000602531.1.88138 WP_000602531.1.88844 WP_000602531.1.8916 WP_000602531.1.89725 WP_000602531.1.90188 WP_000602531.1.90537 WP_000602531.1.90631 WP_000602531.1.90803 WP_000602531.1.91009 WP_000602531.1.91013 WP_000602531.1.91017 WP_000602531.1.91046 WP_000602531.1.91324 WP_000602531.1.92349 WP_000602531.1.92480 WP_000602531.1.9249 WP_000602531.1.93413 WP_000602531.1.95586 WP_000602531.1.95836 WP_000602531.1.96306 WP_000602531.1.96462 WP_000602531.1.9683 WP_000602531.1.96841 WP_000602531.1.97198 WP_000602531.1.97385 WP_000602531.1.97703 WP_000602531.1.98154 WP_000602531.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]