SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 189518.LA2461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189518.LA2461
Domain Number 1 Region: 24-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000647
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 189518.LA2461
Sequence length 98
Comment (Leptospira interrogans serovar Lai)
Sequence
MSKFKIDGKSGKVTIDTVVIDGYDKIFDEVTQSASKGTVLDVEFLLEAVKKITSSGIAKL
LTVKNRMDHYGVKMKIKHLSPDLLEVLKKFKVDDKLGL
Download sequence
Identical sequences A0A098MX29 A0A0C5X3C9 A0A0E2D536 A0A0F6H7Y0 A0A0F6HWD6 A0A0F6I9B6 A0A0M4NZ52 A0A163PY29 A0A1B9FHN3 A0A1N6WIJ4 A0A1V2ZSB6 A0A2H1XGF5 M5ZA10 M6RAP9 Q72S88 Q8F3E5
gi|45657371|ref|YP_001457.1| gi|386074477|ref|YP_005988794.1| NP_712642.1.97817 WP_000032804.1.10054 WP_000032804.1.100607 WP_000032804.1.100943 WP_000032804.1.10099 WP_000032804.1.101113 WP_000032804.1.101360 WP_000032804.1.102083 WP_000032804.1.11367 WP_000032804.1.11416 WP_000032804.1.11890 WP_000032804.1.12132 WP_000032804.1.12257 WP_000032804.1.12296 WP_000032804.1.13846 WP_000032804.1.14057 WP_000032804.1.14181 WP_000032804.1.14552 WP_000032804.1.15012 WP_000032804.1.1506 WP_000032804.1.15739 WP_000032804.1.16487 WP_000032804.1.17129 WP_000032804.1.17260 WP_000032804.1.175 WP_000032804.1.1759 WP_000032804.1.17762 WP_000032804.1.18168 WP_000032804.1.18925 WP_000032804.1.18988 WP_000032804.1.19091 WP_000032804.1.19636 WP_000032804.1.19821 WP_000032804.1.19906 WP_000032804.1.20233 WP_000032804.1.2069 WP_000032804.1.20778 WP_000032804.1.2170 WP_000032804.1.22564 WP_000032804.1.22580 WP_000032804.1.23212 WP_000032804.1.23353 WP_000032804.1.23514 WP_000032804.1.2392 WP_000032804.1.24270 WP_000032804.1.24738 WP_000032804.1.250 WP_000032804.1.25259 WP_000032804.1.25470 WP_000032804.1.25773 WP_000032804.1.26235 WP_000032804.1.26477 WP_000032804.1.26822 WP_000032804.1.27867 WP_000032804.1.28 WP_000032804.1.28517 WP_000032804.1.2987 WP_000032804.1.30744 WP_000032804.1.30921 WP_000032804.1.30957 WP_000032804.1.31178 WP_000032804.1.3128 WP_000032804.1.31321 WP_000032804.1.3175 WP_000032804.1.31926 WP_000032804.1.32453 WP_000032804.1.32692 WP_000032804.1.32859 WP_000032804.1.3288 WP_000032804.1.33670 WP_000032804.1.339 WP_000032804.1.34232 WP_000032804.1.34457 WP_000032804.1.34735 WP_000032804.1.35515 WP_000032804.1.35633 WP_000032804.1.35956 WP_000032804.1.36087 WP_000032804.1.36128 WP_000032804.1.36297 WP_000032804.1.36581 WP_000032804.1.36759 WP_000032804.1.37254 WP_000032804.1.3754 WP_000032804.1.37594 WP_000032804.1.382 WP_000032804.1.38403 WP_000032804.1.39007 WP_000032804.1.39100 WP_000032804.1.39787 WP_000032804.1.39967 WP_000032804.1.40783 WP_000032804.1.41353 WP_000032804.1.41637 WP_000032804.1.42222 WP_000032804.1.42779 WP_000032804.1.4308 WP_000032804.1.43311 WP_000032804.1.43353 WP_000032804.1.43570 WP_000032804.1.44274 WP_000032804.1.44326 WP_000032804.1.45100 WP_000032804.1.45262 WP_000032804.1.45679 WP_000032804.1.4572 WP_000032804.1.46007 WP_000032804.1.46812 WP_000032804.1.46987 WP_000032804.1.47686 WP_000032804.1.47834 WP_000032804.1.48092 WP_000032804.1.48108 WP_000032804.1.48207 WP_000032804.1.48838 WP_000032804.1.49027 WP_000032804.1.49352 WP_000032804.1.50403 WP_000032804.1.50455 WP_000032804.1.50786 WP_000032804.1.50856 WP_000032804.1.50904 WP_000032804.1.51217 WP_000032804.1.51443 WP_000032804.1.51531 WP_000032804.1.5165 WP_000032804.1.51687 WP_000032804.1.51773 WP_000032804.1.52005 WP_000032804.1.52351 WP_000032804.1.53255 WP_000032804.1.53346 WP_000032804.1.5368 WP_000032804.1.5446 WP_000032804.1.54587 WP_000032804.1.55693 WP_000032804.1.55703 WP_000032804.1.55852 WP_000032804.1.56120 WP_000032804.1.56629 WP_000032804.1.5678 WP_000032804.1.56812 WP_000032804.1.58511 WP_000032804.1.58842 WP_000032804.1.59857 WP_000032804.1.60409 WP_000032804.1.60804 WP_000032804.1.6135 WP_000032804.1.61403 WP_000032804.1.61658 WP_000032804.1.6171 WP_000032804.1.61777 WP_000032804.1.62172 WP_000032804.1.62196 WP_000032804.1.62202 WP_000032804.1.63084 WP_000032804.1.63541 WP_000032804.1.63646 WP_000032804.1.63688 WP_000032804.1.64760 WP_000032804.1.64963 WP_000032804.1.65294 WP_000032804.1.65513 WP_000032804.1.65559 WP_000032804.1.65719 WP_000032804.1.6574 WP_000032804.1.66305 WP_000032804.1.668 WP_000032804.1.67052 WP_000032804.1.67243 WP_000032804.1.67344 WP_000032804.1.67411 WP_000032804.1.67421 WP_000032804.1.6761 WP_000032804.1.68135 WP_000032804.1.68426 WP_000032804.1.68799 WP_000032804.1.68993 WP_000032804.1.69136 WP_000032804.1.69218 WP_000032804.1.70155 WP_000032804.1.70516 WP_000032804.1.70913 WP_000032804.1.70921 WP_000032804.1.71080 WP_000032804.1.71461 WP_000032804.1.72166 WP_000032804.1.72187 WP_000032804.1.7280 WP_000032804.1.72830 WP_000032804.1.73107 WP_000032804.1.73302 WP_000032804.1.73583 WP_000032804.1.74258 WP_000032804.1.74515 WP_000032804.1.74558 WP_000032804.1.74792 WP_000032804.1.75054 WP_000032804.1.75316 WP_000032804.1.75377 WP_000032804.1.76063 WP_000032804.1.76404 WP_000032804.1.76970 WP_000032804.1.76971 WP_000032804.1.7707 WP_000032804.1.77178 WP_000032804.1.77242 WP_000032804.1.77874 WP_000032804.1.78069 WP_000032804.1.7821 WP_000032804.1.78364 WP_000032804.1.78551 WP_000032804.1.78739 WP_000032804.1.79237 WP_000032804.1.79939 WP_000032804.1.81113 WP_000032804.1.81443 WP_000032804.1.8167 WP_000032804.1.81803 WP_000032804.1.82080 WP_000032804.1.82375 WP_000032804.1.82393 WP_000032804.1.82978 WP_000032804.1.83052 WP_000032804.1.83201 WP_000032804.1.84222 WP_000032804.1.84376 WP_000032804.1.84406 WP_000032804.1.84450 WP_000032804.1.85034 WP_000032804.1.86863 WP_000032804.1.86894 WP_000032804.1.87123 WP_000032804.1.8721 WP_000032804.1.8748 WP_000032804.1.87797 WP_000032804.1.87860 WP_000032804.1.87965 WP_000032804.1.88006 WP_000032804.1.88138 WP_000032804.1.88844 WP_000032804.1.8916 WP_000032804.1.89725 WP_000032804.1.90188 WP_000032804.1.90537 WP_000032804.1.90631 WP_000032804.1.90803 WP_000032804.1.91009 WP_000032804.1.91013 WP_000032804.1.91017 WP_000032804.1.91046 WP_000032804.1.91324 WP_000032804.1.92349 WP_000032804.1.92480 WP_000032804.1.9249 WP_000032804.1.93413 WP_000032804.1.95586 WP_000032804.1.95836 WP_000032804.1.96306 WP_000032804.1.96462 WP_000032804.1.9683 WP_000032804.1.96841 WP_000032804.1.97198 WP_000032804.1.97216 WP_000032804.1.97385 WP_000032804.1.97703 WP_000032804.1.98154 WP_000032804.1.9886 189518.LA2461 267671.LIC11496 gi|24215161|ref|NP_712642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]