SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_1299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_1299
Domain Number 1 Region: 29-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000188
Family Anti-sigma factor antagonist SpoIIaa 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_1299
Sequence length 141
Comment (Mycobacterium KMS)
Sequence
MSSSIIQPVPSTEPTICHTARFEASAPLPSTTVVTVAGELDAANARDFADFALLHAGGAL
IVDLAGVEFFGTAGFSALHTLNVRCAGADINWILVPSAAVSRLLRICDPDATLPWSESVD
TALTALQGEPRPLLQLVAEPR
Download sequence
Identical sequences A1UCF3
WP_011558693.1.20321 WP_011558693.1.47369 gi|119867349|ref|YP_937301.1| gi|108798253|ref|YP_638450.1| 164756.Mmcs_1282 189918.Mkms_1299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]