SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_1781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_1781
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000097
Family Terminase gpNU1 subunit domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_1781
Sequence length 52
Comment (Mycobacterium KMS)
Sequence
MSRGEIAEYLGVSLATVKGYVDFPEPDVTVGRNQGWAKETVDRWVASRRRAK
Download sequence
Identical sequences A0A1A0TFB5 A0A1X0GZA6 A1UDS4
164757.Mjls_1713 189918.Mkms_1781 gi|119867820|ref|YP_937772.1| gi|126434303|ref|YP_001069994.1| WP_011768170.1.20321 WP_011768170.1.3374 WP_011768170.1.37251 WP_011768170.1.44017 WP_011768170.1.47369 WP_011768170.1.73225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]