SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_5246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_5246
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 1e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_5246
Sequence length 115
Comment (Mycobacterium KMS)
Sequence
MDGQNFGVEQWHGRVAVIRATGAVDMLTAPHLEIAIRAAREKRPTGLIVDLSDAEFLSSA
GMQVLVTTHEELTPGARFAVVAEGPGTSRPLKITGLTDFIELFSTLDAALNTFAE
Download sequence
Identical sequences A0A1A0TVS2 A0A1X0GEA1 A1UNM7
WP_011562532.1.20321 WP_011562532.1.3374 WP_011562532.1.37251 WP_011562532.1.44017 WP_011562532.1.47369 WP_011562532.1.73225 gi|126438101|ref|YP_001073792.1| 164756.Mmcs_5157 164757.Mjls_5538 189918.Mkms_5246 gi|108802120|ref|YP_642317.1| gi|119871273|ref|YP_941225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]