SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_5274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_5274
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_5274
Sequence length 120
Comment (Mycobacterium KMS)
Sequence
MRGDAVVVRVKGDVDSLSVDALNSHLAKARGNAVCHPSRLVVIDLSEVTYFGSAALNAVL
SCHEEGAAEGTSVAIVADQPYVMQPIQITGLHRVLETHPTIEQALQRDGQSPDGEGRTPR
Download sequence
Identical sequences A1UNQ5
gi|108802148|ref|YP_642345.1| gi|119871301|ref|YP_941253.1| 164756.Mmcs_5185 189918.Mkms_5274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]