SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190192.MK0568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190192.MK0568
Domain Number 1 Region: 61-292
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.84e-31
Family D-glucarate dehydratase-like 0.001
Further Details:      
 
Weak hits

Sequence:  190192.MK0568
Domain Number - Region: 4-73
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000294
Family Enolase N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190192.MK0568
Sequence length 301
Comment (Methanopyrus kandleri)
Sequence
MGSLETEPVSLSLKRPFRISGREVRRVRGYWCTCVIEGNSGRGFGLRRGIAEEMATLDAV
ARRYDEPLCRVWGREPASIESFATVDLVGAEQAEKLARRYYLRGYRKLKVKVGGDDLKRD
LERVEACVKSAEFDALILDGNEGLTVEEVFRLLDFLDFDGDVYLEHPTPPDSLEEVCESC
EAPVIVDVMDLGARSIDDVLDVAEPCDIVNIKTQEVGFVGGLRLARDAREEGFKVMVGCA
VESFSSISAAAHLAAAVEADLCDLDGHLFLDEDVVSNPGYAPVMVTEGPGWEVRVERPKP
A
Download sequence
Identical sequences Q8TXU2
190192.MK0568 gi|20094006|ref|NP_613853.1| NYSGXRC-9425a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]