SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190192.MK1501 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190192.MK1501
Domain Number 1 Region: 22-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000426
Family Archaeal DNA-binding protein 0.066
Further Details:      
 
Weak hits

Sequence:  190192.MK1501
Domain Number - Region: 104-129
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0654
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190192.MK1501
Sequence length 268
Comment (Methanopyrus kandleri)
Sequence
MEEGPIRVPNELKDRRELMKSLILAFIGLRQPRVHLGDIGGELGVSLQAIHNYVKELIDE
GLVEKKGRAEYVLTDKGAEKALESINNIRRFSAKIAEALGKRMTWAAIAAEDIRKGEEIY
LYMEDGLLYASKSRKTGARAIAQADAEKGQDLPVTNIEGDIPGLERGEVVFVCVPSAREG
GTRKLDLDRLKEVLEKEDYDLIGAAGTAARAALNMLGIEPDLKFGVVDGAIMAALKGLKA
LVVITTPMLRRARDKAERRGAEYRIQYV
Download sequence
Identical sequences Q8TV91
gi|20094937|ref|NP_614784.1| 190192.MK1501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]