SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190304.FN0358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190304.FN0358
Domain Number 1 Region: 76-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-93
Family RecA protein-like (ATPase-domain) 0.00000000294
Further Details:      
 
Domain Number 2 Region: 345-460
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 2.62e-52
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000582
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.52e-25
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190304.FN0358
Sequence length 462
Comment (Fusobacterium nucleatum)
Sequence
MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTD
GLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLE
TETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVG
ERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLL
FIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVP
ADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARK
VQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVP
VKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDLAK
Download sequence
Identical sequences Q8RGE2
gi|19703700|ref|NP_603262.1| NP_603262.1.20138 WP_011016335.1.7230 190304.FN0358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]