SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190485.XCC0170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190485.XCC0170
Domain Number 1 Region: 744-954
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.007
Further Details:      
 
Domain Number 2 Region: 67-218
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000477
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 
Domain Number 3 Region: 458-646
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000306
Family PFOR PP module 0.08
Further Details:      
 
Domain Number 4 Region: 285-416
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000292
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC0170
Sequence length 1236
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MTSTAALSSPASANTPEIGRVDADYTLEHKYTRADGRIYLSGVQALVRLPLMQHLRDVAA
GLDTAGFVSGYRGSPLGGLDLELWRARAHLEAAKVTFTPGLNEDLAATMVWGTQQTNLFP
GATVQGVYGMWYGKGPGVDRSGDVFKHANAAGTSPFGGVLALAADDHACRSSTLPHGSED
EFVSAMMPILNPAGVQDILDMGLLGWAMSRYTGRWVGFKTIAETVESSASVDVDPFARQI
VLPDDFALPPGGLSIRWPDPPVDQEMRLHRYAVAAAQAFARANGIDKLVLDSPQARLGIV
TTGKSYLDVLQALEYLGLDAQACAQIGIRVYKVGMTWPLEPVGITAFARGLDDIVVVEEK
KAFIERQMKELFYNWPASAGARPSIVGKYNEHGAWILPSTGELTPATIAAVIGKRIQRFP
LPSAAIAASIEQRLRWMEAKEAEMALPRALFPRVPHYCSGCPHNTSTVVPEGSRALGGIG
CHYMVTWMNRSTDTFTHMGGEGVTWSGQAPFTATPHVFQNLGDGTYFHSGSLAIRQSVAT
GVNITYKILYNDAVAMTGGQPVDGTLTVPDIAHQLRAEGIHEIVVVSDDIGKWTRRRERF
PSDVAFHDRSELDAVQQRLRTIKGVSILIFDQTCATEKRRRRKRGKLIDPPKRVMINSLV
CEGCGDCGEKSFCVSVLPKDTEFGRKREIDQSNCNKDYSCVSGFCPSFVTVHGGAPRKGK
KRDASALLDALPEPPQRTTLEQPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQT
GLAQKGGAVTTHIRIARQPADIHAVRIAAGEADLVLGCDMVVVNDYWALSKVRDGRTQVV
LNTYEAMPGSFTTQPDLQFPAAEIIAGVRTALGGQEPLLLDATQLATALLGDAIASNLFV
LGYAWQHGLVPLSHAALMRAIELNGAAVAMNQQAFAWGRLAAVDLPAVQRAAGLAPALDT
AAHAHAATPPSRGPGSWEDHDMSGQSAPRALAQTDADTLHADGDAPVHPLDDEQLAQSLD
EAIARRVHFLTDYQDAAYAQQYRALVERVRTHEAQRAPGSTALSAAVARYAFKLMAYKDE
YEVARLYTRGDFQRRVQQQFEGDYQLRFHLAPPLFAKKDANGQPIKREYGPWMFSAFKLL
ARLKFLRGGKLDVFGYTAERRGERQLIADYLATVNTLLQRLDNDNVGLAAQIASIPEHIR
GYGHVKDAHLHEAKAREAALLAQWRNPKALHVVQAA
Download sequence
Identical sequences 190485.XCC0170 314565.XC_0179 gi|77747738|ref|NP_635565.2| NP_635565.2.47755 WP_011035427.1.1732 WP_011035427.1.18295 WP_011035427.1.27778 WP_011035427.1.31612 WP_011035427.1.40219 WP_011035427.1.56666 gi|77761075|ref|YP_241286.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]