SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190485.XCC0635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  190485.XCC0635
Domain Number - Region: 14-74
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0141
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC0635
Sequence length 370
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MIKPQPPRIEQDSQDHAEVRLAGSWVLATALPQAELLQAVPDGVRRIDARGIGQLDSAGV
LQLLRFASRMGLKEDAIDFRDEHQALVCTIEELNDERPKPKRDYGFVAALDRLGRTTHGV
GQGILELNSFLGENLVKIARLIHEPRRFRLTSTVHHMEQVGLDAVPLVVLLSYLVGAVIA
FLGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDA
IRTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHD
TIQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAI
AALWFMKMGW
Download sequence
Identical sequences A0A0H2XAS9 Q8PCS7
gi|21230110|ref|NP_636027.1| NP_636027.1.47755 WP_011035878.1.15229 WP_011035878.1.16446 WP_011035878.1.18295 WP_011035878.1.18975 WP_011035878.1.27778 WP_011035878.1.36449 WP_011035878.1.475 WP_011035878.1.80866 WP_011035878.1.89271 gi|66769899|ref|YP_244661.1| 190485.XCC0635 314565.XC_3599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]