SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190485.XCC1172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190485.XCC1172
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000186
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC1172
Sequence length 120
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MERIPILRMGDLLLVTIQVDMHDQLALTLQEDLSEKISATSARGVLIDISALDIVDSFIG
RMISTISGLAAIMDAKTVVVGMQPAVAITLVELGLTLPTVRTALNVERGMRLLQQPVLDP
Download sequence
Identical sequences A0A0H2X9L7 B0RY11 G0CHV0 Q8PBF0
gi|21230629|ref|NP_636546.1| gi|66769375|ref|YP_244137.1| NP_636546.1.47755 WP_011036369.1.10627 WP_011036369.1.12135 WP_011036369.1.12496 WP_011036369.1.15229 WP_011036369.1.16446 WP_011036369.1.1732 WP_011036369.1.18295 WP_011036369.1.18975 WP_011036369.1.22538 WP_011036369.1.25266 WP_011036369.1.27778 WP_011036369.1.31612 WP_011036369.1.36111 WP_011036369.1.36449 WP_011036369.1.40219 WP_011036369.1.40437 WP_011036369.1.43481 WP_011036369.1.4502 WP_011036369.1.475 WP_011036369.1.56666 WP_011036369.1.80866 WP_011036369.1.82601 WP_011036369.1.88278 WP_011036369.1.89271 190485.XCC1172 314565.XC_3071 509169.xccb100_3166 gi|188992561|ref|YP_001904571.1| gi|384427063|ref|YP_005636421.1| APC65642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]