SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190486.XAC1905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190486.XAC1905
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000145
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190486.XAC1905
Sequence length 102
Comment (Xanthomonas citri)
Sequence
MSTVTLGEDLGIETSADLKQKLAGFLTQDGDLVLDAGEVRRIHTASVQLLCAFVQSRRQA
GLHTEFDGCNDTFRDAARLLGVTDALGLPASNDNLKSVENAA
Download sequence
Identical sequences A0A0A6TIR4 A0A0G9AVZ3 A0A0N8TN36 A0A0U5FD26 A0A0W7YIN0 A0A1A9MD55 A0A1C3NRV7 A0A1D9EJA4 A0A1S1XIP9 A0A1T1QK33 A0A1T1RVT3 A0A1U8ZLP7 A0A220WI32 A0A221MNL4 A0A2D2RQG6 D4SQB0 D4T470 G2LRT9 H8FKC3 M4TVN7 Q3BU74 Q8PL98 U4M7J9
gi|21242649|ref|NP_642231.1| gi|471268003|ref|YP_007650468.1| 190486.XAC1905 316273.XCV1958 WP_003489692.1.100156 WP_003489692.1.100312 WP_003489692.1.100431 WP_003489692.1.101491 WP_003489692.1.101581 WP_003489692.1.101846 WP_003489692.1.101985 WP_003489692.1.102013 WP_003489692.1.10442 WP_003489692.1.10882 WP_003489692.1.1092 WP_003489692.1.11230 WP_003489692.1.12064 WP_003489692.1.12457 WP_003489692.1.1263 WP_003489692.1.12827 WP_003489692.1.13318 WP_003489692.1.13350 WP_003489692.1.13735 WP_003489692.1.14032 WP_003489692.1.14159 WP_003489692.1.14165 WP_003489692.1.14945 WP_003489692.1.15350 WP_003489692.1.15539 WP_003489692.1.15678 WP_003489692.1.16263 WP_003489692.1.16332 WP_003489692.1.17112 WP_003489692.1.17148 WP_003489692.1.17215 WP_003489692.1.18336 WP_003489692.1.19065 WP_003489692.1.19305 WP_003489692.1.19505 WP_003489692.1.19776 WP_003489692.1.199 WP_003489692.1.20043 WP_003489692.1.2014 WP_003489692.1.20169 WP_003489692.1.21004 WP_003489692.1.21227 WP_003489692.1.21303 WP_003489692.1.21317 WP_003489692.1.21440 WP_003489692.1.22109 WP_003489692.1.22114 WP_003489692.1.2230 WP_003489692.1.2259 WP_003489692.1.22678 WP_003489692.1.22888 WP_003489692.1.23342 WP_003489692.1.23375 WP_003489692.1.23534 WP_003489692.1.24172 WP_003489692.1.24624 WP_003489692.1.2476 WP_003489692.1.2491 WP_003489692.1.25231 WP_003489692.1.25999 WP_003489692.1.26095 WP_003489692.1.27112 WP_003489692.1.28321 WP_003489692.1.28779 WP_003489692.1.29361 WP_003489692.1.29860 WP_003489692.1.3003 WP_003489692.1.30380 WP_003489692.1.30571 WP_003489692.1.30677 WP_003489692.1.30778 WP_003489692.1.31364 WP_003489692.1.31392 WP_003489692.1.32205 WP_003489692.1.3308 WP_003489692.1.331 WP_003489692.1.34035 WP_003489692.1.34103 WP_003489692.1.3440 WP_003489692.1.35047 WP_003489692.1.35540 WP_003489692.1.35849 WP_003489692.1.3651 WP_003489692.1.3654 WP_003489692.1.3710 WP_003489692.1.37228 WP_003489692.1.37257 WP_003489692.1.37259 WP_003489692.1.37569 WP_003489692.1.37942 WP_003489692.1.38016 WP_003489692.1.38217 WP_003489692.1.39371 WP_003489692.1.39696 WP_003489692.1.40308 WP_003489692.1.40689 WP_003489692.1.40690 WP_003489692.1.41197 WP_003489692.1.41216 WP_003489692.1.41431 WP_003489692.1.42335 WP_003489692.1.42602 WP_003489692.1.42745 WP_003489692.1.43379 WP_003489692.1.43396 WP_003489692.1.43419 WP_003489692.1.43567 WP_003489692.1.43799 WP_003489692.1.43832 WP_003489692.1.4389 WP_003489692.1.44297 WP_003489692.1.44794 WP_003489692.1.45126 WP_003489692.1.45197 WP_003489692.1.46272 WP_003489692.1.46449 WP_003489692.1.46464 WP_003489692.1.46677 WP_003489692.1.47244 WP_003489692.1.47501 WP_003489692.1.47697 WP_003489692.1.47707 WP_003489692.1.47931 WP_003489692.1.47958 WP_003489692.1.48351 WP_003489692.1.49137 WP_003489692.1.49886 WP_003489692.1.50405 WP_003489692.1.51018 WP_003489692.1.51091 WP_003489692.1.52184 WP_003489692.1.52218 WP_003489692.1.5224 WP_003489692.1.52489 WP_003489692.1.52767 WP_003489692.1.53417 WP_003489692.1.5365 WP_003489692.1.53650 WP_003489692.1.54158 WP_003489692.1.54200 WP_003489692.1.54709 WP_003489692.1.55132 WP_003489692.1.55770 WP_003489692.1.55809 WP_003489692.1.55935 WP_003489692.1.56030 WP_003489692.1.56075 WP_003489692.1.56262 WP_003489692.1.56360 WP_003489692.1.56391 WP_003489692.1.56804 WP_003489692.1.57452 WP_003489692.1.57989 WP_003489692.1.58141 WP_003489692.1.58382 WP_003489692.1.58982 WP_003489692.1.59619 WP_003489692.1.59630 WP_003489692.1.59767 WP_003489692.1.6015 WP_003489692.1.60328 WP_003489692.1.60406 WP_003489692.1.60785 WP_003489692.1.61221 WP_003489692.1.61498 WP_003489692.1.61945 WP_003489692.1.61999 WP_003489692.1.62152 WP_003489692.1.62531 WP_003489692.1.6260 WP_003489692.1.63386 WP_003489692.1.64411 WP_003489692.1.64541 WP_003489692.1.65037 WP_003489692.1.65450 WP_003489692.1.656 WP_003489692.1.66420 WP_003489692.1.67180 WP_003489692.1.6771 WP_003489692.1.67877 WP_003489692.1.67913 WP_003489692.1.6829 WP_003489692.1.6838 WP_003489692.1.68383 WP_003489692.1.68402 WP_003489692.1.70026 WP_003489692.1.70193 WP_003489692.1.70738 WP_003489692.1.71126 WP_003489692.1.71284 WP_003489692.1.71353 WP_003489692.1.71699 WP_003489692.1.72092 WP_003489692.1.72305 WP_003489692.1.72777 WP_003489692.1.72810 WP_003489692.1.73738 WP_003489692.1.74035 WP_003489692.1.74121 WP_003489692.1.74279 WP_003489692.1.7523 WP_003489692.1.75313 WP_003489692.1.75734 WP_003489692.1.76206 WP_003489692.1.76535 WP_003489692.1.7704 WP_003489692.1.772 WP_003489692.1.77810 WP_003489692.1.78066 WP_003489692.1.78220 WP_003489692.1.78473 WP_003489692.1.79359 WP_003489692.1.79366 WP_003489692.1.79878 WP_003489692.1.79879 WP_003489692.1.79906 WP_003489692.1.80421 WP_003489692.1.80602 WP_003489692.1.80975 WP_003489692.1.81086 WP_003489692.1.81486 WP_003489692.1.81489 WP_003489692.1.81510 WP_003489692.1.81579 WP_003489692.1.81711 WP_003489692.1.82045 WP_003489692.1.82073 WP_003489692.1.83358 WP_003489692.1.83628 WP_003489692.1.85024 WP_003489692.1.85152 WP_003489692.1.8544 WP_003489692.1.85778 WP_003489692.1.86099 WP_003489692.1.86317 WP_003489692.1.8651 WP_003489692.1.87207 WP_003489692.1.87349 WP_003489692.1.87455 WP_003489692.1.88516 WP_003489692.1.88706 WP_003489692.1.88740 WP_003489692.1.88988 WP_003489692.1.89206 WP_003489692.1.89212 WP_003489692.1.89360 WP_003489692.1.89772 WP_003489692.1.90138 WP_003489692.1.90200 WP_003489692.1.90226 WP_003489692.1.90230 WP_003489692.1.90594 WP_003489692.1.91667 WP_003489692.1.92002 WP_003489692.1.92041 WP_003489692.1.92912 WP_003489692.1.9340 WP_003489692.1.93402 WP_003489692.1.93813 WP_003489692.1.94147 WP_003489692.1.94705 WP_003489692.1.94781 WP_003489692.1.94946 WP_003489692.1.95108 WP_003489692.1.96073 WP_003489692.1.96108 WP_003489692.1.96329 WP_003489692.1.96706 WP_003489692.1.96800 WP_003489692.1.97098 WP_003489692.1.97233 WP_003489692.1.97426 WP_003489692.1.98344 WP_003489692.1.98824 WP_003489692.1.9928 WP_003489692.1.99285 WP_003489692.1.99816 WP_003489692.1.99907 gi|78047514|ref|YP_363689.1| gi|470471792|ref|YP_007636360.1| gi|346724838|ref|YP_004851507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]