SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190486.XAC2088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190486.XAC2088
Domain Number 1 Region: 52-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000144
Family RecA protein-like (ATPase-domain) 0.087
Further Details:      
 
Weak hits

Sequence:  190486.XAC2088
Domain Number - Region: 251-316
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00518
Family D-glucarate dehydratase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190486.XAC2088
Sequence length 345
Comment (Xanthomonas citri)
Sequence
MSKRGTRTPGYWYDNTPIPLPARILAPVYGAAIALRRALYRRGWRRRHGVPVPVIVVGNV
TAGGTGKTPLTIALVAKLQEAGWTPGVASRGYGRDDAGTARWVEADTPVALGGDEPVLIA
WKTGARVRVDSDRLAAARALVEAGCDIVICDDGLQHYRLARDVEIEVVDGQRRYGNGRLL
PAGPLREPAARAQDCDFRVVNLGQASATATPQAPDDAGFGKWQMRLSIDSVQPMDGKRAQ
PLSMLAGQRVHAVAGIAHPERFFAMLRARGIGVVPHAFADHHVYRAADFSFGSRLPVLMT
EKDAVKCRPFADEWLYSVPLKAELPAAFWVSLLDRLNKLASRQGV
Download sequence
Identical sequences A0A0U5BT69 A0A1T1S078 M4TW53 Q8PKS4
XaR29 190486.XAC2088 WP_011051325.1.101581 WP_011051325.1.13318 WP_011051325.1.13350 WP_011051325.1.14945 WP_011051325.1.18336 WP_011051325.1.19505 WP_011051325.1.21004 WP_011051325.1.22109 WP_011051325.1.22678 WP_011051325.1.28779 WP_011051325.1.30380 WP_011051325.1.30778 WP_011051325.1.31392 WP_011051325.1.35047 WP_011051325.1.35540 WP_011051325.1.37228 WP_011051325.1.38217 WP_011051325.1.39696 WP_011051325.1.41216 WP_011051325.1.41431 WP_011051325.1.43799 WP_011051325.1.43832 WP_011051325.1.46272 WP_011051325.1.47697 WP_011051325.1.47707 WP_011051325.1.53417 WP_011051325.1.56391 WP_011051325.1.56804 WP_011051325.1.58382 WP_011051325.1.61945 WP_011051325.1.62531 WP_011051325.1.6260 WP_011051325.1.63386 WP_011051325.1.6829 WP_011051325.1.70193 WP_011051325.1.71126 WP_011051325.1.71284 WP_011051325.1.72810 WP_011051325.1.76206 WP_011051325.1.79879 WP_011051325.1.80421 WP_011051325.1.80602 WP_011051325.1.82073 WP_011051325.1.87455 WP_011051325.1.88516 WP_011051325.1.88706 WP_011051325.1.88988 WP_011051325.1.89206 WP_011051325.1.90138 WP_011051325.1.90200 WP_011051325.1.90226 WP_011051325.1.92002 WP_011051325.1.92041 WP_011051325.1.92912 WP_011051325.1.94705 WP_011051325.1.96706 gi|470471967|ref|YP_007636535.1| gi|21242827|ref|NP_642409.1| gi|471267262|ref|YP_007649727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]