SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190486.XAC3430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190486.XAC3430
Domain Number 1 Region: 30-244
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-53
Family Voltage-gated potassium channels 0.00028
Further Details:      
 
Weak hits

Sequence:  190486.XAC3430
Domain Number - Region: 247-279
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0558
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190486.XAC3430
Sequence length 290
Comment (Xanthomonas citri)
Sequence
MRPFSDPQLTAATDDGWRRQWFDIIYRHDTRPSRNFDLMLVVAILASVVVIMIDSVPRIH
SHAADWLVPLEWAFTVIFTIEYALRLSVVRRPLHYALSVWGVIDLLSILPSYLSFFVPGA
QTLLVVRVLRILRLFRILKLTRYIEESGQLLDALWRSRRKVLVFLFTVLTITVIAGATMY
IIEGPQHGFTSIPTSMYWAIVTMATVGFGDLVPQTTLGRFVTSALILIGYSIIAVPTGIY
TAELASSLREGGHTGKRDARNCARCGLEGHAVDARYCRQCAEPLPELGNG
Download sequence
Identical sequences A0A1D9EFI3 A0A1T1PC10 A0A1T1SD10 A0A2G5JSC4 M4U008 Q8PH30
gi|21244155|ref|NP_643737.1| GO.668 gi|470473297|ref|YP_007637865.1| 190486.XAC3430 gi|471269621|ref|YP_007652086.1| WP_011052272.1.101581 WP_011052272.1.13318 WP_011052272.1.13350 WP_011052272.1.14945 WP_011052272.1.15350 WP_011052272.1.18336 WP_011052272.1.19505 WP_011052272.1.21004 WP_011052272.1.22109 WP_011052272.1.22678 WP_011052272.1.23375 WP_011052272.1.28779 WP_011052272.1.29860 WP_011052272.1.30380 WP_011052272.1.30778 WP_011052272.1.31392 WP_011052272.1.3308 WP_011052272.1.35047 WP_011052272.1.35540 WP_011052272.1.37228 WP_011052272.1.38217 WP_011052272.1.39341 WP_011052272.1.39696 WP_011052272.1.41216 WP_011052272.1.41431 WP_011052272.1.42745 WP_011052272.1.43799 WP_011052272.1.43832 WP_011052272.1.46272 WP_011052272.1.46464 WP_011052272.1.47697 WP_011052272.1.47707 WP_011052272.1.53417 WP_011052272.1.55935 WP_011052272.1.56030 WP_011052272.1.56391 WP_011052272.1.56804 WP_011052272.1.58141 WP_011052272.1.58382 WP_011052272.1.59630 WP_011052272.1.60328 WP_011052272.1.61945 WP_011052272.1.61999 WP_011052272.1.62531 WP_011052272.1.6260 WP_011052272.1.63386 WP_011052272.1.67913 WP_011052272.1.6829 WP_011052272.1.70026 WP_011052272.1.70193 WP_011052272.1.71126 WP_011052272.1.71284 WP_011052272.1.72810 WP_011052272.1.76206 WP_011052272.1.79879 WP_011052272.1.80421 WP_011052272.1.80602 WP_011052272.1.81086 WP_011052272.1.81510 WP_011052272.1.82073 WP_011052272.1.82115 WP_011052272.1.87455 WP_011052272.1.88516 WP_011052272.1.88706 WP_011052272.1.88988 WP_011052272.1.89206 WP_011052272.1.90138 WP_011052272.1.90200 WP_011052272.1.90226 WP_011052272.1.90594 WP_011052272.1.92002 WP_011052272.1.92041 WP_011052272.1.92912 WP_011052272.1.94705 WP_011052272.1.96706 WP_011052272.1.99816 WP_011052272.1.99907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]