SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 190650.CC_0532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190650.CC_0532
Domain Number 1 Region: 99-387
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.41e-78
Family D-glucarate dehydratase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.23e-32
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190650.CC_0532
Sequence length 403
Comment (Caulobacter crescentus)
Sequence
MLKIIDAKVIVTCPGRNFVTLKITTEDGITGVGDATLNGRELSVVSFLQDHMVPSLIGRD
AHQIEDIWQFFYRGSYWRGGPVAMTALAAVDMALWDIKGKVAGLPVYQLLGGACRTGVTV
YGHANGETIEDTIAEAVKYKAMGYKAIRLQTGVPGLASTYGVSKDKMFYEPADNDLPTEN
IWSTAKYLNSVPKLFERAREVLGWDVHLLHDVHHRLTPIEAARLGKDLEPYRLFWLEDSV
PAENQAGFRLIRQHTTTPLAVGEIFAHVWDAKQLIEEQLIDYLRATVLHAGGITNLKKIA
AFADLHHVKTGCHGATDLSPVTMAAALHFDMSITNFGLQEYMRHTPETDAVFPHAYTFSD
GMLHPGDKPGLGVDIDEDLAAKHPYKRAYLPVNRLEDGTMFNW
Download sequence
Identical sequences A0A0H3C643 Q9AAR4
gi|16124787|ref|NP_419351.1| 190650.CC_0532 565050.CCNA_00566 gi|221233503|ref|YP_002515939.1| NP_419351.1.61804 YP_002515939.1.80956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]