SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190650.CC_3751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190650.CC_3751
Domain Number 1 Region: 231-343
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0000000000000306
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.044
Further Details:      
 
Domain Number 2 Region: 22-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000276
Family Extended AAA-ATPase domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190650.CC_3751
Sequence length 350
Comment (Caulobacter crescentus)
Sequence
MILSKRPDVERFLKEPTPDIRAVVIYGKDRGVVRDRANALARRVVERPDDPFDTAQLTDG
DLDADPAKLEDELSAMSLMGGRRLVRLRLSSDKAGPDKQAAEALTRHVEGQLNPDAFFLV
EAGALGRDSQLRKVGEKANGCAVIPCYEDEAGDLARLTRDTLANDKVSVNSEALELFVSR
LPKERGVARAEIERLALYLGPGSGINATAADLTDFLGVEPEASLSDAAADAFGGKVGAAQ
QALRRAAAEGEGGPAAVRAMGYYLGRLRRVLTLHKNGVDLQAAAKAAGVFWKQEREFLRQ
ARAWNLEAILEIQGEILTADRACKTSGSPDQLIAERLALMIAGRARRLGL
Download sequence
Identical sequences Q9A215
190650.CC_3751 NP_422545.1.61804 gi|16127981|ref|NP_422545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]