SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 192952.MM_1342 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  192952.MM_1342
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-53
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 192952.MM_1342
Sequence length 182
Comment (Methanosarcina mazei)
Sequence
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRISDSPIRL
RSQIYAPDYVIVQDATLLETVDVASGIKDDGIIIVNTTEKPESLKLNTKAKVMTVDATKV
AMDVMGIPIVNTVLLGAFAGATGEINVESIQKAIRARFSGKIGEKNAKAIQKAYQLIRGE
EK
Download sequence
Identical sequences A0A0E3RL58 Q8PX80
192952.MM_1342 WP_011033288.1.49674 WP_011033288.1.90340 gi|21227444|ref|NP_633366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]