SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 192952.MM_2635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  192952.MM_2635
Domain Number 1 Region: 21-214
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 192952.MM_2635
Sequence length 230
Comment (Methanosarcina mazei)
Sequence
MKDEGTISERTAEGTKRPAGMKYDILIAGVGGQGVVLASRILALSAMKAGFRVSTAETIG
MSQREGSVSSHVRIGDEISGSLIPEGKADLLIGLEPAETIRNLPFLKEGGKIIVNSHAIP
PASKPPGSPEYNPGALLSYLKTGFPDFFCLDFTRLAEEAGTYRAANVAMIGAAAGMGILP
FSKEIVLALMEAEIPEKHRAVNRAAFEEAVKKIKLISTSQDGKQKVKSNV
Download sequence
Identical sequences A0A0E3PXI0 A0A0E3RBY1 A0A0E3RG96 A0A0E3RRQ4 A0A0E3RX46 M1PBU3 Q8PTS7
WP_011034547.1.12270 WP_011034547.1.13782 WP_011034547.1.14209 WP_011034547.1.14583 WP_011034547.1.16483 WP_011034547.1.18729 WP_011034547.1.2157 WP_011034547.1.21629 WP_011034547.1.23878 WP_011034547.1.29103 WP_011034547.1.33522 WP_011034547.1.40449 WP_011034547.1.43564 WP_011034547.1.43834 WP_011034547.1.49674 WP_011034547.1.53770 WP_011034547.1.62876 WP_011034547.1.64722 WP_011034547.1.7135 WP_011034547.1.75785 WP_011034547.1.7642 WP_011034547.1.82674 WP_011034547.1.90340 WP_011034547.1.95514 gi|452211145|ref|YP_007491259.1| 192952.MM_2635 gi|21228737|ref|NP_634659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]