SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 194439.CT0163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT0163
Domain Number 1 Region: 246-506
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-59
Family Pyruvate oxidase and decarboxylase Pyr module 0.025
Further Details:      
 
Domain Number 2 Region: 19-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 
Domain Number 3 Region: 521-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000985
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 194439.CT0163
Sequence length 627
Comment (Chlorobium tepidum TLS)
Sequence
MSDTVILNNNDMVISKTNVSVLFAGDSGDGMQLTGTQFANTVAVYGSDLNTFPNFPSEIR
PPAGTVAGVSGFQLQFGTTGVYTPGAKFDVMIAMNAAALKANLKNLHHGGIIIADTDGFD
AKNLNLAGYGETNNPLEDGTLTDYTVFKIPVISLTRQALADTGLSTKIIDRCKNMFVLGV
LYWLYSLPLETTIEALQSKFKNKQDIAEANIKAVKAGYNFGDETEMFSQHGRFCVPPAQK
KKGVYRRVTGNEASAIGLAAAAQKAGLELFLGSYPITPASEILQTLAGLKKWGVKTFQAE
DEIAGILTSIGAAYGGALAATNTSGPGLALKTEGMGLAVILELPLVIINVMRGGPSTGLP
TKPEQSDLLMAMYGRHGEAPMPVIAAMSPVDCFYAAYEAAKIAVEYMTPVLCLTDGYLAL
SSEPMLVPSPDELASITPMFSPERKADDPPYLPYKRDERCVRPWGIPGTPGLEHRIGGLE
KQNETGHVSHDPENHALMTRLRAEKVAKVADIIPDLTIDNGPEKGDLLVLGWGSTYGAIK
KAVEQAREGGLDVAHAHLRYINPFPKNLGAMLGNFKKVLIPENNCGQLLSLIRDKFLIEP
VGFSKVQGLPFNEMEIEEKITDILKEL
Download sequence
Identical sequences Q8KG07
NP_661069.1.51846 194439.CT0163 APC36334.0 gi|21673004|ref|NP_661069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]