SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 194439.CT0167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT0167
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000437
Family Ferredoxin domains from multidomain proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 194439.CT0167
Sequence length 87
Comment (Chlorobium tepidum TLS)
Sequence
MPREEIPWFPVIKPELCNGCGDCKVLCKPGVFELGEPDPTGIHRPKLIVAHPMNCLVLCD
RCVPICTSGAIVLPKKEDFEKYVEYLD
Download sequence
Identical sequences Q8KG03
gi|21673008|ref|NP_661073.1| NP_661073.1.51846 194439.CT0167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]