SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 194439.CT1719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT1719
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.26e-31
Family cAMP-binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 142-220
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000242
Family CAP C-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 194439.CT1719
Sequence length 225
Comment (Chlorobium tepidum TLS)
Sequence
MSLDNNKGKASHATRQILEKYLTLRSFRKGQLLWSEGDTDGLLVFLKSGRVKIYRLLPMG
KAITLYIFGKGSVFGFMPFFDDAPYPAYAQALDDCEADVISRSGLRQAVHQDPEVAIVLM
KQLAQRLRDAFDTIERLQSKGANPKVAAALMALMDDSPNIAGRPLFITLPVASHEFAQSL
GLTPETLSRSITHLVEKNILKRLQRNRFQILDLEALEKVAESALR
Download sequence
Identical sequences Q8KBR5
390738 APC88977 NP_662600.1.51846 gi|21674535|ref|NP_662600.1| 194439.CT1719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]