SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195099.CJE0642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195099.CJE0642
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 195099.CJE0642
Sequence length 185
Comment (Campylobacter jejuni RM1221)
Sequence
MKYQLRFGGEGGQGVITAGEILAEAAIKEGRQAFKASTYTSQVRGGPTKVDIIIDDKEIL
FPYAVEGEVDFMLSTADKGYKGFRGGVKEGGIIVVEPNLVHPESEDYKKWQIFEIPIITI
AKDEVGNVATQSVVALAIAAYMSKCIDLDVLKETMLHMVPAKTRDANAKAFDLGVKYATQ
AKPYS
Download sequence
Identical sequences A0A0B6TR02 A0A0E1ZLU3 A0A0W8KXJ5 A0A1E7P7M1 A0A2K1WJ42 A5KF83
gi|57238262|ref|YP_178657.1| gi|384447818|ref|YP_005655869.1| WP_002812564.1.100068 WP_002812564.1.100358 WP_002812564.1.100416 WP_002812564.1.100792 WP_002812564.1.100842 WP_002812564.1.100958 WP_002812564.1.100968 WP_002812564.1.101120 WP_002812564.1.101242 WP_002812564.1.101346 WP_002812564.1.101513 WP_002812564.1.101664 WP_002812564.1.101723 WP_002812564.1.101807 WP_002812564.1.101886 WP_002812564.1.102088 WP_002812564.1.10462 WP_002812564.1.10601 WP_002812564.1.10699 WP_002812564.1.10782 WP_002812564.1.11022 WP_002812564.1.11065 WP_002812564.1.11288 WP_002812564.1.11336 WP_002812564.1.11684 WP_002812564.1.12021 WP_002812564.1.12799 WP_002812564.1.13240 WP_002812564.1.13264 WP_002812564.1.13404 WP_002812564.1.13562 WP_002812564.1.13648 WP_002812564.1.13689 WP_002812564.1.1376 WP_002812564.1.13900 WP_002812564.1.14014 WP_002812564.1.1410 WP_002812564.1.14405 WP_002812564.1.14447 WP_002812564.1.14571 WP_002812564.1.14576 WP_002812564.1.14781 WP_002812564.1.154 WP_002812564.1.15561 WP_002812564.1.1679 WP_002812564.1.16796 WP_002812564.1.16820 WP_002812564.1.16926 WP_002812564.1.17095 WP_002812564.1.17171 WP_002812564.1.17462 WP_002812564.1.17486 WP_002812564.1.17852 WP_002812564.1.18051 WP_002812564.1.18219 WP_002812564.1.18253 WP_002812564.1.1828 WP_002812564.1.1875 WP_002812564.1.18954 WP_002812564.1.19041 WP_002812564.1.19078 WP_002812564.1.1908 WP_002812564.1.19202 WP_002812564.1.19381 WP_002812564.1.19580 WP_002812564.1.19695 WP_002812564.1.19714 WP_002812564.1.19870 WP_002812564.1.20077 WP_002812564.1.20237 WP_002812564.1.20285 WP_002812564.1.20333 WP_002812564.1.20368 WP_002812564.1.20645 WP_002812564.1.208 WP_002812564.1.20879 WP_002812564.1.20956 WP_002812564.1.21754 WP_002812564.1.21770 WP_002812564.1.21857 WP_002812564.1.22160 WP_002812564.1.22321 WP_002812564.1.22817 WP_002812564.1.23143 WP_002812564.1.23610 WP_002812564.1.24037 WP_002812564.1.2411 WP_002812564.1.24438 WP_002812564.1.24558 WP_002812564.1.24671 WP_002812564.1.24675 WP_002812564.1.24698 WP_002812564.1.24720 WP_002812564.1.24806 WP_002812564.1.24986 WP_002812564.1.2510 WP_002812564.1.25144 WP_002812564.1.25211 WP_002812564.1.25369 WP_002812564.1.25665 WP_002812564.1.25943 WP_002812564.1.26 WP_002812564.1.26081 WP_002812564.1.26214 WP_002812564.1.26248 WP_002812564.1.26458 WP_002812564.1.26739 WP_002812564.1.26811 WP_002812564.1.27041 WP_002812564.1.27100 WP_002812564.1.27276 WP_002812564.1.27433 WP_002812564.1.27444 WP_002812564.1.2792 WP_002812564.1.28065 WP_002812564.1.2807 WP_002812564.1.28240 WP_002812564.1.28285 WP_002812564.1.28815 WP_002812564.1.2958 WP_002812564.1.29637 WP_002812564.1.29773 WP_002812564.1.29808 WP_002812564.1.29837 WP_002812564.1.30116 WP_002812564.1.30396 WP_002812564.1.30486 WP_002812564.1.30575 WP_002812564.1.3062 WP_002812564.1.30663 WP_002812564.1.30895 WP_002812564.1.31398 WP_002812564.1.31560 WP_002812564.1.31676 WP_002812564.1.31747 WP_002812564.1.32103 WP_002812564.1.32115 WP_002812564.1.32302 WP_002812564.1.32513 WP_002812564.1.32595 WP_002812564.1.3307 WP_002812564.1.33150 WP_002812564.1.33162 WP_002812564.1.33256 WP_002812564.1.33317 WP_002812564.1.33739 WP_002812564.1.33958 WP_002812564.1.34283 WP_002812564.1.34488 WP_002812564.1.34552 WP_002812564.1.3501 WP_002812564.1.35079 WP_002812564.1.35241 WP_002812564.1.35952 WP_002812564.1.36032 WP_002812564.1.36233 WP_002812564.1.36407 WP_002812564.1.36649 WP_002812564.1.37082 WP_002812564.1.37639 WP_002812564.1.38315 WP_002812564.1.38714 WP_002812564.1.3900 WP_002812564.1.39194 WP_002812564.1.39429 WP_002812564.1.39743 WP_002812564.1.39750 WP_002812564.1.40511 WP_002812564.1.41150 WP_002812564.1.41164 WP_002812564.1.41380 WP_002812564.1.41421 WP_002812564.1.41619 WP_002812564.1.41676 WP_002812564.1.41745 WP_002812564.1.41766 WP_002812564.1.41786 WP_002812564.1.41840 WP_002812564.1.42543 WP_002812564.1.42609 WP_002812564.1.43183 WP_002812564.1.43217 WP_002812564.1.43574 WP_002812564.1.43760 WP_002812564.1.44006 WP_002812564.1.44039 WP_002812564.1.4421 WP_002812564.1.44221 WP_002812564.1.44249 WP_002812564.1.44298 WP_002812564.1.44383 WP_002812564.1.45151 WP_002812564.1.45391 WP_002812564.1.45438 WP_002812564.1.46176 WP_002812564.1.46763 WP_002812564.1.468 WP_002812564.1.46943 WP_002812564.1.46988 WP_002812564.1.47446 WP_002812564.1.4756 WP_002812564.1.48021 WP_002812564.1.48271 WP_002812564.1.48314 WP_002812564.1.485 WP_002812564.1.48794 WP_002812564.1.48803 WP_002812564.1.49316 WP_002812564.1.49596 WP_002812564.1.50170 WP_002812564.1.50213 WP_002812564.1.50297 WP_002812564.1.50385 WP_002812564.1.50400 WP_002812564.1.50614 WP_002812564.1.50763 WP_002812564.1.50812 WP_002812564.1.5097 WP_002812564.1.51026 WP_002812564.1.5103 WP_002812564.1.51053 WP_002812564.1.51298 WP_002812564.1.51415 WP_002812564.1.51618 WP_002812564.1.52362 WP_002812564.1.52387 WP_002812564.1.52620 WP_002812564.1.5263 WP_002812564.1.52702 WP_002812564.1.52711 WP_002812564.1.52732 WP_002812564.1.53003 WP_002812564.1.53793 WP_002812564.1.53913 WP_002812564.1.53979 WP_002812564.1.5402 WP_002812564.1.54060 WP_002812564.1.54071 WP_002812564.1.54092 WP_002812564.1.54441 WP_002812564.1.54452 WP_002812564.1.54592 WP_002812564.1.54780 WP_002812564.1.55153 WP_002812564.1.55240 WP_002812564.1.55476 WP_002812564.1.55481 WP_002812564.1.55555 WP_002812564.1.55661 WP_002812564.1.55875 WP_002812564.1.56094 WP_002812564.1.56397 WP_002812564.1.56688 WP_002812564.1.56766 WP_002812564.1.56922 WP_002812564.1.56983 WP_002812564.1.57275 WP_002812564.1.5737 WP_002812564.1.57437 WP_002812564.1.57498 WP_002812564.1.57733 WP_002812564.1.5784 WP_002812564.1.57958 WP_002812564.1.58002 WP_002812564.1.5843 WP_002812564.1.58505 WP_002812564.1.58576 WP_002812564.1.5888 WP_002812564.1.59093 WP_002812564.1.59195 WP_002812564.1.59358 WP_002812564.1.59383 WP_002812564.1.59550 WP_002812564.1.59555 WP_002812564.1.59795 WP_002812564.1.60034 WP_002812564.1.60397 WP_002812564.1.60399 WP_002812564.1.60531 WP_002812564.1.60548 WP_002812564.1.61064 WP_002812564.1.61249 WP_002812564.1.61283 WP_002812564.1.61383 WP_002812564.1.61465 WP_002812564.1.61717 WP_002812564.1.61761 WP_002812564.1.6187 WP_002812564.1.62153 WP_002812564.1.6224 WP_002812564.1.62305 WP_002812564.1.62423 WP_002812564.1.62439 WP_002812564.1.62451 WP_002812564.1.62457 WP_002812564.1.6254 WP_002812564.1.62545 WP_002812564.1.62672 WP_002812564.1.63100 WP_002812564.1.63528 WP_002812564.1.63837 WP_002812564.1.6402 WP_002812564.1.64025 WP_002812564.1.64482 WP_002812564.1.64592 WP_002812564.1.64790 WP_002812564.1.64878 WP_002812564.1.65073 WP_002812564.1.6545 WP_002812564.1.65500 WP_002812564.1.65644 WP_002812564.1.65735 WP_002812564.1.65741 WP_002812564.1.65833 WP_002812564.1.66405 WP_002812564.1.66467 WP_002812564.1.66520 WP_002812564.1.66785 WP_002812564.1.66802 WP_002812564.1.66885 WP_002812564.1.67015 WP_002812564.1.67069 WP_002812564.1.67138 WP_002812564.1.67216 WP_002812564.1.67511 WP_002812564.1.67675 WP_002812564.1.67818 WP_002812564.1.67847 WP_002812564.1.68389 WP_002812564.1.6862 WP_002812564.1.68625 WP_002812564.1.68786 WP_002812564.1.68826 WP_002812564.1.69031 WP_002812564.1.69312 WP_002812564.1.69516 WP_002812564.1.69737 WP_002812564.1.6976 WP_002812564.1.69860 WP_002812564.1.70474 WP_002812564.1.7062 WP_002812564.1.70749 WP_002812564.1.70788 WP_002812564.1.71045 WP_002812564.1.71377 WP_002812564.1.71465 WP_002812564.1.71472 WP_002812564.1.7176 WP_002812564.1.71776 WP_002812564.1.71813 WP_002812564.1.71884 WP_002812564.1.72159 WP_002812564.1.72197 WP_002812564.1.72239 WP_002812564.1.72313 WP_002812564.1.72519 WP_002812564.1.72607 WP_002812564.1.72709 WP_002812564.1.72723 WP_002812564.1.72863 WP_002812564.1.73090 WP_002812564.1.73097 WP_002812564.1.73138 WP_002812564.1.73321 WP_002812564.1.73406 WP_002812564.1.73534 WP_002812564.1.73810 WP_002812564.1.73972 WP_002812564.1.74125 WP_002812564.1.74140 WP_002812564.1.74315 WP_002812564.1.74360 WP_002812564.1.74472 WP_002812564.1.7481 WP_002812564.1.74864 WP_002812564.1.75460 WP_002812564.1.75611 WP_002812564.1.7643 WP_002812564.1.76546 WP_002812564.1.76559 WP_002812564.1.76658 WP_002812564.1.76904 WP_002812564.1.77207 WP_002812564.1.77380 WP_002812564.1.77573 WP_002812564.1.77662 WP_002812564.1.77828 WP_002812564.1.78159 WP_002812564.1.78310 WP_002812564.1.78406 WP_002812564.1.78614 WP_002812564.1.78684 WP_002812564.1.79025 WP_002812564.1.79231 WP_002812564.1.79430 WP_002812564.1.79449 WP_002812564.1.79510 WP_002812564.1.79535 WP_002812564.1.79613 WP_002812564.1.79770 WP_002812564.1.79833 WP_002812564.1.79874 WP_002812564.1.79937 WP_002812564.1.80202 WP_002812564.1.80633 WP_002812564.1.80652 WP_002812564.1.80788 WP_002812564.1.80807 WP_002812564.1.80825 WP_002812564.1.81435 WP_002812564.1.81447 WP_002812564.1.81520 WP_002812564.1.81578 WP_002812564.1.81664 WP_002812564.1.81680 WP_002812564.1.81737 WP_002812564.1.8175 WP_002812564.1.81793 WP_002812564.1.82083 WP_002812564.1.82126 WP_002812564.1.82311 WP_002812564.1.82383 WP_002812564.1.82640 WP_002812564.1.83436 WP_002812564.1.83819 WP_002812564.1.83895 WP_002812564.1.840 WP_002812564.1.84246 WP_002812564.1.84261 WP_002812564.1.84677 WP_002812564.1.84803 WP_002812564.1.84835 WP_002812564.1.84961 WP_002812564.1.85240 WP_002812564.1.85309 WP_002812564.1.85714 WP_002812564.1.85725 WP_002812564.1.85911 WP_002812564.1.86555 WP_002812564.1.86579 WP_002812564.1.87184 WP_002812564.1.87295 WP_002812564.1.87429 WP_002812564.1.87527 WP_002812564.1.87669 WP_002812564.1.88134 WP_002812564.1.88515 WP_002812564.1.88713 WP_002812564.1.88784 WP_002812564.1.88833 WP_002812564.1.88835 WP_002812564.1.88889 WP_002812564.1.88927 WP_002812564.1.89384 WP_002812564.1.89485 WP_002812564.1.89661 WP_002812564.1.89687 WP_002812564.1.90075 WP_002812564.1.90216 WP_002812564.1.9044 WP_002812564.1.91047 WP_002812564.1.91326 WP_002812564.1.91330 WP_002812564.1.91537 WP_002812564.1.91661 WP_002812564.1.91753 WP_002812564.1.9176 WP_002812564.1.9194 WP_002812564.1.9231 WP_002812564.1.92325 WP_002812564.1.92449 WP_002812564.1.92725 WP_002812564.1.92761 WP_002812564.1.92983 WP_002812564.1.93020 WP_002812564.1.93029 WP_002812564.1.93057 WP_002812564.1.93549 WP_002812564.1.93575 WP_002812564.1.93617 WP_002812564.1.93654 WP_002812564.1.9372 WP_002812564.1.93864 WP_002812564.1.94467 WP_002812564.1.94534 WP_002812564.1.94535 WP_002812564.1.94631 WP_002812564.1.94660 WP_002812564.1.94802 WP_002812564.1.95087 WP_002812564.1.95360 WP_002812564.1.95773 WP_002812564.1.9582 WP_002812564.1.9591 WP_002812564.1.96104 WP_002812564.1.96265 WP_002812564.1.96302 WP_002812564.1.96501 WP_002812564.1.96525 WP_002812564.1.96527 WP_002812564.1.96616 WP_002812564.1.96886 WP_002812564.1.9689 WP_002812564.1.97085 WP_002812564.1.97120 WP_002812564.1.97347 WP_002812564.1.97629 WP_002812564.1.97790 WP_002812564.1.97809 WP_002812564.1.98210 WP_002812564.1.98358 WP_002812564.1.98367 WP_002812564.1.98782 WP_002812564.1.99003 WP_002812564.1.99021 WP_002812564.1.99042 WP_002812564.1.99085 WP_002812564.1.99129 WP_002812564.1.9920 WP_002812564.1.9929 WP_002812564.1.99444 WP_002812564.1.99612 WP_002812564.1.99811 WP_002812564.1.99893 WP_002812564.1.99960 gi|544062206|ref|YP_008561911.1| gi|543945973|ref|YP_008538477.1| 195099.CJE0642 gi|543949532|ref|YP_008541876.1| gi|543947745|ref|YP_008540146.1| gi|549692534|ref|YP_008623492.1| gi|407941975|ref|YP_006857615.1| gi|384442869|ref|YP_005659121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]