SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195102.CPE1059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195102.CPE1059
Domain Number 1 Region: 73-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000034
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  195102.CPE1059
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0479
Family Haloperoxidase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 195102.CPE1059
Sequence length 137
Comment (Clostridium perfringens)
Sequence
MLWLWVVVILAGIIIDYLSSDVLFVGFSFGALGGLVLAFLDVNVILQFILFSIITILFFF
YVYPKIKRKIKVDNIGTKTMEQSYIGRKIILDENVEDSALIKFEGIYWTFKSVSGPLKKG
TEVEIIGIEGNKILIKK
Download sequence
Identical sequences A0A174BAG4 B1R8S9 Q8XLI2
gi|18310041|ref|NP_561975.1| WP_003458591.1.22226 WP_003458591.1.27257 WP_003458591.1.27537 WP_003458591.1.32463 WP_003458591.1.43003 WP_003458591.1.81392 GO.2594 195102.CPE1059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]