SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195102.CPE1891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  195102.CPE1891
Domain Number - Region: 210-303
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000419
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 195102.CPE1891
Sequence length 446
Comment (Clostridium perfringens)
Sequence
MYIKLTKKIKFSAVQILALGFSMVILLGAIILSLPISSKSGEFTPFLDSLFTSTSAVCVT
GLITLNTAAHWNYFGKTVIIILIQIGGLGFMSFTTLFALMVKKKITLRERLLIQEAMNTF
GIQGLVRMIRYILAFTFSVEMLGALLLSTQFIPKFGFLKGIYYSIWYSISAFCNAGFDLF
GDNLVGYANNKTVILTIAALIVIGGLGFTVWSELYNYKGYKKLSLHSKVVIMITAILLIG
GAILMFIFEYNNPNTLKYMSFGDKLTNAFFASATTRTAGFNSVSTADMTLAGKFLTILLM
FVGGSPGSTAGGIKTATFGIVVLTLISIIRGREDTEVFKKRISKELVYKAFAVLFIGFGI
VVLGTLILAVTEPGFSLEYILYEVTSAFATVGLTLGLTPYLSVIGKIIIIITMYLGRVGP
MTVVLALANRKKPSAYKYPEDKILIG
Download sequence
Identical sequences Q8XJ70
GO.601 WP_011010665.1.32463 195102.CPE1891 gi|18310873|ref|NP_562807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]