SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 195103.CPF_1315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195103.CPF_1315
Domain Number 1 Region: 73-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000392
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  195103.CPF_1315
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0495
Family Haloperoxidase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 195103.CPF_1315
Sequence length 137
Comment (Clostridium perfringens ATCC 13124)
Sequence
MLWLWVVVILAGIIIDYLSSDVLFVGFSFGALGGLVLAFLDVNVILQFILFSIITILFFF
YVYPKIKRKIKVDNIGTKTMEQSYIGRKIILDENVEDSSLIKFEGIYWTFKSVSGPLKKG
TEVEIIGIEGNKILIKK
Download sequence
Identical sequences A0A0H2YPX5 A0A133MZ73 B1BF38 B1BY26 B1V597
gi|110798980|ref|YP_695761.1| WP_003448822.1.100517 WP_003448822.1.10161 WP_003448822.1.2058 WP_003448822.1.20964 WP_003448822.1.24595 WP_003448822.1.30163 WP_003448822.1.31832 WP_003448822.1.35472 WP_003448822.1.4402 WP_003448822.1.50147 WP_003448822.1.50713 WP_003448822.1.51349 WP_003448822.1.52260 WP_003448822.1.5234 WP_003448822.1.52659 WP_003448822.1.5667 WP_003448822.1.68380 WP_003448822.1.90682 195103.CPF_1315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]