SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_0371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_0371
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-28
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_0371
Sequence length 112
Comment (Nocardioides JS614)
Sequence
MDLTLTTRDAGGKTIVAVGGEIDVYTAPKLRDKITELVAAGVYDIVVDMEEVEFLDSTGL
GVLVGGLKKVRAHDGSLQLVCTQDRLLKIFRITGLAKVFVIHDSADAALAGS
Download sequence
Identical sequences A1SDM9
WP_011753865.1.100580 WP_011753865.1.96005 gi|119714636|ref|YP_921601.1| 196162.Noca_0371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]