SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_0845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_0845
Domain Number 1 Region: 137-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.39e-63
Family D-glucarate dehydratase-like 0.00029
Further Details:      
 
Domain Number 2 Region: 24-153
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.24e-21
Family Enolase N-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_0845
Sequence length 392
Comment (Nocardioides JS614)
Sequence
MSTAPAPAVSAVRAASTLSADDLTIERIEVIPMRVPLARLFQGSHYSMSTRCTIVTRLHT
RCGLVSEVYNGDTDAEQSVIVGIIRDEIVPQLIGRSALAHESCWEAMLPPTYDILRDRSV
ALQAIACLDSAIWDVVGKAVGLPLFQLWGGYRDRLPAICIGGYYSDDEADIGRQIERYLD
LGFAGCKFKVGRLTPAEDAHRTRLARKAAGDDFVLMVDANQGFTRRGAIEFAGLTEDLDL
RWFEEPVGWVNDRLSMRDVRLTTGIQVVAGQSEDTRAGLRDLITAGAVDACNADASWIGG
PSEWRRVAALASMYEVDMAHHEEPQISAHLLASIPHGTYLETFDPDRDPIFWNMIANRRP
FQDGDYLVPEGPGFGLELDWDYIERYRSDPAS
Download sequence
Identical sequences A1SEY3
NYSGXRC-9813a 196162.Noca_0845 gi|119715090|ref|YP_922055.1| WP_011754317.1.100580 WP_011754317.1.96005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]