SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_2577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_2577
Domain Number 1 Region: 85-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000353
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_2577
Sequence length 153
Comment (Nocardioides JS614)
Sequence
MDWLGEHAWAAWLGVAAVLGMAELVSLDLVLIMLAVGALAGMVTAALGAAVVLQVLVAGG
AAVAMLALVRPSLVERLHRGPELRLGTSKLVGQRALVTQRITGLSVGRIRLAGETWSAAP
YDEHVTIEPGATVEVFEIRGATAYVHPVSELEE
Download sequence
Identical sequences A1SJU6
gi|119716803|ref|YP_923768.1| WP_011756021.1.100580 WP_011756021.1.96005 196162.Noca_2577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]