SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196164.CE2303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196164.CE2303
Domain Number 1 Region: 129-370
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-67
Family D-glucarate dehydratase-like 0.000012
Further Details:      
 
Domain Number 2 Region: 4-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.31e-31
Family Enolase N-terminal domain-like 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196164.CE2303
Sequence length 373
Comment (Corynebacterium efficiens YS-314)
Sequence
MADLTINRVESRILDVPLIRPHGFATTTSTVQHILLVSVHLDNGVTGYGEGVVPGGPWWG
GESVETMKALVDGYLAPVLVGREVSELAGIMADLERVVARGRYAKAAVDVAMHDAWARAL
NVSVRDLLGGTVRTELDCTWALGVLPLEVAVEEIEERIATWGNRSFKLKMGAGEPAEDTR
RVAELAREVGDRVSLRIDINARWDRLTALRYLPELADAGIELFEQPTPADDLETLREITR
RTNVSVMADESVWTPAEALAVVKSQAADVIALKTTKHGGLLESKKIAAIAEAGGLACHGA
TSLEGPIGTAASLQFAASTKAVSYGTELFGPQLLKDTYVVQDIEYRDGLVIVPQGPGLGV
ELDMDKINFYTRN
Download sequence
Identical sequences WP_006768307.1.13007 WP_006768307.1.3528 gi|161485963|ref|NP_738913.2| 196164.CE2303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]