SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VV0985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV0985
Domain Number 1 Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000615
Family NfeD domain-like 0.0043
Further Details:      
 
Weak hits

Sequence:  196600.VV0985
Domain Number - Region: 28-74
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0106
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196600.VV0985
Sequence length 152
Comment (Vibrio vulnificus YJ016)
Sequence
MIELLDGINHWHWLALGLALLAVELLGTAGYFLWLGLSALLVGLLLSLIPMSWQLQWSAF
AVFSLVTTWLWWRRQLAKDQQDDSSRDLNQKQKQLVGQEIILKEDIHAGMNRIQVADTTW
SAHSDSDIPAGSKIKIIALDGIVLKVEVQATP
Download sequence
Identical sequences Q7MMT2
gi|37679169|ref|NP_933778.1| WP_011149761.1.34622 196600.VV0985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]