SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VVA0580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VVA0580
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily Globin-like 6.29e-37
Family Globins 0.0065
Further Details:      
 
Domain Number 2 Region: 177-289
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196600.VVA0580
Sequence length 306
Comment (Vibrio vulnificus YJ016)
Sequence
MSLGSVLNKVEDADELLKLHDLTEADLALIRKFGQIMVPKLDEYVKHFYDWLRNTPEYEQ
YFGDAQKLQRVQDSQVRYWKTFFDARIDSAYLKERRNVGEIHARVGLPLPTYFAGMNISM
VIFTKRMYDGSLYSDEYSSLVTAFTKLLHLDTTIVVDTYSRLINKRISEQSEALLAMSTP
VTMIWQDILMLPIVGIIDSKRAQDIMSAVLNKISENRAKIFIMDISGVAVVDTAVANHFI
KITKATKLMGCDCLVSGVSPSIARTMVQLGINVGEVRTNATLRDALENAFKIVGLTVSGL
KHFPHE
Download sequence
Identical sequences Q7MEU0
WP_011151938.1.34622 WP_011151938.1.39407 gi|37676240|ref|NP_936636.1| 196600.VVA0580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]