SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196600.VVA1683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VVA1683
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196600.VVA1683
Sequence length 99
Comment (Vibrio vulnificus YJ016)
Sequence
MSVMKEVDKTSNTVTLAIEGAFGFNLVQEFRNAYTEHLNSQFIIDLRKVDYIDSAGLGML
LNMQKHLNSADGRIKIINTLPQVRKILLISRFDKKFHIE
Download sequence
Identical sequences A0A087JFR0 A0A0H0XZ46 A0A1L9KUK6 Q7MBQ7
gi|37677343|ref|NP_937739.1| WP_011082053.1.100126 WP_011082053.1.13374 WP_011082053.1.16238 WP_011082053.1.17874 WP_011082053.1.21633 WP_011082053.1.22486 WP_011082053.1.22778 WP_011082053.1.24453 WP_011082053.1.25536 WP_011082053.1.28215 WP_011082053.1.28571 WP_011082053.1.30871 WP_011082053.1.31968 WP_011082053.1.33883 WP_011082053.1.34622 WP_011082053.1.39407 WP_011082053.1.39524 WP_011082053.1.43691 WP_011082053.1.47396 WP_011082053.1.49981 WP_011082053.1.512 WP_011082053.1.53345 WP_011082053.1.53782 WP_011082053.1.54486 WP_011082053.1.54603 WP_011082053.1.54858 WP_011082053.1.55006 WP_011082053.1.553 WP_011082053.1.58875 WP_011082053.1.58885 WP_011082053.1.59022 WP_011082053.1.59048 WP_011082053.1.59451 WP_011082053.1.60167 WP_011082053.1.60868 WP_011082053.1.61535 WP_011082053.1.63462 WP_011082053.1.63825 WP_011082053.1.65015 WP_011082053.1.66219 WP_011082053.1.66581 WP_011082053.1.67868 WP_011082053.1.73066 WP_011082053.1.73173 WP_011082053.1.78369 WP_011082053.1.78668 WP_011082053.1.79678 WP_011082053.1.81060 WP_011082053.1.81460 WP_011082053.1.81555 WP_011082053.1.82587 WP_011082053.1.8292 WP_011082053.1.8379 WP_011082053.1.84562 WP_011082053.1.86005 WP_011082053.1.86748 WP_011082053.1.89979 WP_011082053.1.90288 WP_011082053.1.93668 WP_011082053.1.94371 WP_011082053.1.95941 WP_011082053.1.96968 WP_011082053.1.9921 WP_011082053.1.99976 gi|27367541|ref|NP_763068.1| 196600.VVA1683 216895.VV2_1159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]