SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196620.MW1734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196620.MW1734
Domain Number 1 Region: 138-320
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-28
Family D-glucarate dehydratase-like 0.00094
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.48e-19
Family Enolase N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196620.MW1734
Sequence length 333
Comment (Staphylococcus aureus MW2)
Sequence
MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
YGATVSGLSNKQLESLKATKPARIKLKWTPQIMHQIRVLRELEFHFQLVIDANESLDRQD
FTQLQLLAREQVLYIEEPFKDISMLDEVVDGTIPPIALDEKATSLLDIINLIELYNVKVV
VLKPFRLGGIDKVQTAIDTLKSHGVKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY
Download sequence
Identical sequences A0A0H3JY13 A0A1D4DEG6
gi|49486615|ref|YP_043836.1| WP_000778532.1.101330 WP_000778532.1.101406 WP_000778532.1.101598 WP_000778532.1.101922 WP_000778532.1.102066 WP_000778532.1.11228 WP_000778532.1.1457 WP_000778532.1.15241 WP_000778532.1.20690 WP_000778532.1.2434 WP_000778532.1.24503 WP_000778532.1.28866 WP_000778532.1.28915 WP_000778532.1.29315 WP_000778532.1.29716 WP_000778532.1.30496 WP_000778532.1.31426 WP_000778532.1.31505 WP_000778532.1.33765 WP_000778532.1.34334 WP_000778532.1.36932 WP_000778532.1.38390 WP_000778532.1.38862 WP_000778532.1.38960 WP_000778532.1.40340 WP_000778532.1.43530 WP_000778532.1.44899 WP_000778532.1.45654 WP_000778532.1.46195 WP_000778532.1.47493 WP_000778532.1.47541 WP_000778532.1.47629 WP_000778532.1.53323 WP_000778532.1.53418 WP_000778532.1.57196 WP_000778532.1.57723 WP_000778532.1.58419 WP_000778532.1.58538 WP_000778532.1.61009 WP_000778532.1.61897 WP_000778532.1.64994 WP_000778532.1.65046 WP_000778532.1.65600 WP_000778532.1.6612 WP_000778532.1.74273 WP_000778532.1.76149 WP_000778532.1.78598 WP_000778532.1.79270 WP_000778532.1.81010 WP_000778532.1.83066 WP_000778532.1.8328 WP_000778532.1.85160 WP_000778532.1.85292 WP_000778532.1.8551 WP_000778532.1.86606 WP_000778532.1.87272 WP_000778532.1.88753 WP_000778532.1.88761 WP_000778532.1.9055 WP_000778532.1.9071 WP_000778532.1.92918 WP_000778532.1.92960 WP_000778532.1.93736 WP_000778532.1.95476 WP_000778532.1.96022 WP_000778532.1.97444 WP_000778532.1.98497 196620.MW1734 282459.SAS1716 gi|21283463|ref|NP_646551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]