SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 196627.cg1731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196627.cg1731
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000902
Family NfeD domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196627.cg1731
Sequence length 142
Comment (Corynebacterium glutamicum ATCC 13032 Bielefeld)
Sequence
MGAIIWFIGALVLAGLELAVGEFTLLMLGGAALATAGVALIGVPVWAEFVTFAVASAALL
MFIRPAIRKRLLKPKVLDSSPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTF
AEGEIVSVIDIQGTTAIVWKEA
Download sequence
Identical sequences A0A072Z853 A0A0F6SR83 A0A0S2T4Z4
GO.2728 gi|62390416|ref|YP_225818.1| gi|62390416|ref|YP_225818.1| gi|530315670|ref|YP_008401634.1| gi|62390416|ref|YP_225818.1| NP_600749.1.3765 WP_003862316.1.101982 WP_003862316.1.10402 WP_003862316.1.16698 WP_003862316.1.21641 WP_003862316.1.28154 WP_003862316.1.31689 WP_003862316.1.32149 WP_003862316.1.36395 WP_003862316.1.3871 WP_003862316.1.40227 WP_003862316.1.4395 WP_003862316.1.50302 WP_003862316.1.54841 WP_003862316.1.57609 WP_003862316.1.57855 WP_003862316.1.61613 WP_003862316.1.80527 WP_003862316.1.81948 WP_003862316.1.84807 WP_003862316.1.91554 WP_003862316.1.9512 196627.cg1731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]