SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 197221.tlr1901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr1901
Domain Number 1 Region: 11-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-58
Family ABC transporter ATPase domain-like 0.0000187
Further Details:      
 
Weak hits

Sequence:  197221.tlr1901
Domain Number - Region: 243-279
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0641
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr1901
Sequence length 319
Comment (Thermosynechococcus elongatus)
Sequence
MVISADGDRPPVVAVENLQKSYRTGFWLQTVLTPLKSISLQVQPGETFGLLGPNGAGKTT
LLKILLGLVRPSAGSGTLLGYPLGDRAVRQRIGYLPENPYFYDYLTAWEFLEFTAGLFGL
SAATCKERIPLLLEMVGLNLKDARKKQMRRYSKGMVQRVGLAQALINDPEVVFLDEPMSG
LDPLGRYQIREIILSLKQQGKTIFFNSHVLADVEAICDRVGILAQGELICAGTVDELLGS
SQAYHVVGKGGHVDGLQEWLYSLEIQGDRWQGVIKIPLQRFLALVEEMGGKILQLRLARP
TLEEFFVEQLRQKGIQVTH
Download sequence
Identical sequences Q8DHP4
197221.tlr1901 NP_682691.1.97157 gi|22299444|ref|NP_682691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]