SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 197221.tlr2146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  197221.tlr2146
Domain Number 1 Region: 440-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000549
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 197221.tlr2146
Sequence length 561
Comment (Thermosynechococcus elongatus)
Sequence
MLSNLVNRVHFRYWRGDLFGGLTAAIVALPMALAFGVTSGAGATAGLYCVIFLGFFAALF
GGTPTLISNPTGPMTVVITAVITRLTSEYPEQGLYMAFTVVMLAGCFQILFGLLRLGKYI
TLMPYTVISGFMSGIGLIMILLQIGPLLGHSSKGGVLGAVQNLPEWIQTLNPAALTLGLF
TLGLIYFTPQNIRRLVPPQLLALVLGTILSMVFFADAGLARIGTIPTGLPEFVPPTFTLP
ALKTMIVDGAMLGMLGCIDSLLTSVIADSITRTQHDSNKELIGQGIGNLLSGLFGGLPGA
GATMGTVVNIQAGGRTCLSGMIHAVILLMVVLWAAPLTEPIPNAVLAGILIKVGIDIIDW
NFLKRAHLLSLRAAFIMYGVMLLTVFVDLIVAVGVGVFIANMLTIKRLADLQSEEVKAIT
HADDQTPLTPEEKELFGEAKGQLLLLHLGGPMSFGSAWAISQRQAIMADYRVLILDVSSV
PLLGVTATLAIESLIQEAQKHGLGIFLVNGSADKVQQRLQRFRILDRLPAEHVVSDRRQA
LEKAIQLLRQPKESLELTTGS
Download sequence
Identical sequences Q8DH14
gi|22299689|ref|NP_682936.1| NP_682936.1.97157 197221.tlr2146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]