SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 198214.SF0433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198214.SF0433
Domain Number 1 Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000929
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  198214.SF0433
Domain Number - Region: 31-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000484
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 198214.SF0433
Sequence length 151
Comment (Shigella flexneri 2a)
Sequence
MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMFA
ILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSW
PVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences B7L7B3 C8U2H4 C8UIS2 E3PFV3 J7QMY1 J7RQS8 Q325A7 Q3Z4Q9
gi|82542982|ref|YP_406929.1| 2479S YBBJ_ECOLI NP_706381.2.23235 gi|388476593|ref|YP_488779.1| 198214.SF0433 198215.S0440 300268.SBO_0390 300269.SSON_0477 316385.ECDH10B_0445 316407.ybbJ 573235.ECO26_0523 585034.ECIAI1_0491 585055.EC55989_0501 585395.ECO103_0464 585396.ECO111_0523 gi|30061988|ref|NP_836159.1| gi|74311069|ref|YP_309488.1| gi|471332610|ref|YP_007556087.1| gi|260866649|ref|YP_003233051.1| gi|170080073|ref|YP_001729393.1| gi|260853711|ref|YP_003227602.1| gi|218553054|ref|YP_002385967.1| gi|387611012|ref|YP_006114128.1| gi|56479672|ref|NP_706381.2| gi|218693950|ref|YP_002401617.1| gi|260842688|ref|YP_003220466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]