SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 198215.S2474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198215.S2474
Domain Number 1 Region: 104-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-50
Family D-glucarate dehydratase-like 0.00000000678
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.65e-29
Family Enolase N-terminal domain-like 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 198215.S2474
Sequence length 320
Comment (Shigella flexneri 2a 2457T)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQENWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSPLPLVDADVQEQLL
Download sequence
Identical sequences A0A127GMK9 A0A1W2MAK3 A0A200LER2 A0A226KBL7 D2AFW7 Q83QT6
gi|384543919|ref|YP_005727982.1| gi|24113637|ref|NP_708147.1| gi|30063692|ref|NP_837863.1| 198214.SF2340 198215.S2474 NP_708147.1.23235 WP_001255584.1.101522 WP_001255584.1.101545 WP_001255584.1.101667 WP_001255584.1.10226 WP_001255584.1.10361 WP_001255584.1.11912 WP_001255584.1.12965 WP_001255584.1.13157 WP_001255584.1.17680 WP_001255584.1.17711 WP_001255584.1.19024 WP_001255584.1.19148 WP_001255584.1.19453 WP_001255584.1.20484 WP_001255584.1.22328 WP_001255584.1.22409 WP_001255584.1.22522 WP_001255584.1.22771 WP_001255584.1.22896 WP_001255584.1.23622 WP_001255584.1.2395 WP_001255584.1.2433 WP_001255584.1.24547 WP_001255584.1.25038 WP_001255584.1.25799 WP_001255584.1.26005 WP_001255584.1.27472 WP_001255584.1.27957 WP_001255584.1.28491 WP_001255584.1.2931 WP_001255584.1.30640 WP_001255584.1.3176 WP_001255584.1.35368 WP_001255584.1.35649 WP_001255584.1.35698 WP_001255584.1.36129 WP_001255584.1.37155 WP_001255584.1.37549 WP_001255584.1.37637 WP_001255584.1.37730 WP_001255584.1.38119 WP_001255584.1.38202 WP_001255584.1.39063 WP_001255584.1.39358 WP_001255584.1.41339 WP_001255584.1.41391 WP_001255584.1.41449 WP_001255584.1.41513 WP_001255584.1.42448 WP_001255584.1.43561 WP_001255584.1.44222 WP_001255584.1.4445 WP_001255584.1.44627 WP_001255584.1.44671 WP_001255584.1.4535 WP_001255584.1.45392 WP_001255584.1.45799 WP_001255584.1.45949 WP_001255584.1.46429 WP_001255584.1.47775 WP_001255584.1.49823 WP_001255584.1.51206 WP_001255584.1.51600 WP_001255584.1.52406 WP_001255584.1.54032 WP_001255584.1.54755 WP_001255584.1.54989 WP_001255584.1.55070 WP_001255584.1.56358 WP_001255584.1.57150 WP_001255584.1.57348 WP_001255584.1.57395 WP_001255584.1.58136 WP_001255584.1.59165 WP_001255584.1.59226 WP_001255584.1.60342 WP_001255584.1.63350 WP_001255584.1.63612 WP_001255584.1.64153 WP_001255584.1.64793 WP_001255584.1.64930 WP_001255584.1.65484 WP_001255584.1.66059 WP_001255584.1.66978 WP_001255584.1.6701 WP_001255584.1.67412 WP_001255584.1.69404 WP_001255584.1.69868 WP_001255584.1.70191 WP_001255584.1.70251 WP_001255584.1.70341 WP_001255584.1.71158 WP_001255584.1.71724 WP_001255584.1.72342 WP_001255584.1.72449 WP_001255584.1.72748 WP_001255584.1.74509 WP_001255584.1.75124 WP_001255584.1.75505 WP_001255584.1.76447 WP_001255584.1.76460 WP_001255584.1.76957 WP_001255584.1.77198 WP_001255584.1.78041 WP_001255584.1.78377 WP_001255584.1.80463 WP_001255584.1.81582 WP_001255584.1.81876 WP_001255584.1.81956 WP_001255584.1.82507 WP_001255584.1.83286 WP_001255584.1.83321 WP_001255584.1.83340 WP_001255584.1.84164 WP_001255584.1.84986 WP_001255584.1.84990 WP_001255584.1.85008 WP_001255584.1.85416 WP_001255584.1.85969 WP_001255584.1.86483 WP_001255584.1.88735 WP_001255584.1.89998 WP_001255584.1.90065 WP_001255584.1.90314 WP_001255584.1.92123 WP_001255584.1.93605 WP_001255584.1.94190 WP_001255584.1.95254 WP_001255584.1.95712 WP_001255584.1.96128 WP_001255584.1.96608 WP_001255584.1.96680 WP_001255584.1.96769 WP_001255584.1.96932 WP_001255584.1.97279 WP_001255584.1.97815 WP_001255584.1.98323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]