SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 198215.S2994 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  198215.S2994
Domain Number 1 Region: 139-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-81
Family D-glucarate dehydratase-like 0.0000000000613
Further Details:      
 
Domain Number 2 Region: 8-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.13e-30
Family Enolase N-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 198215.S2994
Sequence length 446
Comment (Shigella flexneri 2a 2457T)
Sequence
MSSQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDASGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDDSCDWYRLRHE
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAW
SLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPEKPGLGVEIDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Download sequence
Identical sequences A0A127GNT4 A0A200LAH5 A0A226KEC5 D2AIM0 F5N6D7 I6BGE8 Q83QD4
198214.SF2800 198215.S2994 gi|384544361|ref|YP_005728424.1| NP_708581.1.23235 WP_000098267.1.101522 WP_000098267.1.101545 WP_000098267.1.101667 WP_000098267.1.10226 WP_000098267.1.10361 WP_000098267.1.11912 WP_000098267.1.12965 WP_000098267.1.13157 WP_000098267.1.17711 WP_000098267.1.19024 WP_000098267.1.19148 WP_000098267.1.19453 WP_000098267.1.20136 WP_000098267.1.20484 WP_000098267.1.21029 WP_000098267.1.22098 WP_000098267.1.22328 WP_000098267.1.22409 WP_000098267.1.22522 WP_000098267.1.22771 WP_000098267.1.22896 WP_000098267.1.23622 WP_000098267.1.2395 WP_000098267.1.2433 WP_000098267.1.24547 WP_000098267.1.25038 WP_000098267.1.25799 WP_000098267.1.26005 WP_000098267.1.27472 WP_000098267.1.27957 WP_000098267.1.2931 WP_000098267.1.30640 WP_000098267.1.3176 WP_000098267.1.35368 WP_000098267.1.35649 WP_000098267.1.35698 WP_000098267.1.36129 WP_000098267.1.37155 WP_000098267.1.37549 WP_000098267.1.37637 WP_000098267.1.37730 WP_000098267.1.37830 WP_000098267.1.38119 WP_000098267.1.38202 WP_000098267.1.39063 WP_000098267.1.39286 WP_000098267.1.39358 WP_000098267.1.41339 WP_000098267.1.41391 WP_000098267.1.41449 WP_000098267.1.41513 WP_000098267.1.41539 WP_000098267.1.43133 WP_000098267.1.43561 WP_000098267.1.44222 WP_000098267.1.4445 WP_000098267.1.44627 WP_000098267.1.44671 WP_000098267.1.45000 WP_000098267.1.4535 WP_000098267.1.45392 WP_000098267.1.45799 WP_000098267.1.45949 WP_000098267.1.46429 WP_000098267.1.47775 WP_000098267.1.4953 WP_000098267.1.49823 WP_000098267.1.51600 WP_000098267.1.51736 WP_000098267.1.52406 WP_000098267.1.5291 WP_000098267.1.54032 WP_000098267.1.54755 WP_000098267.1.54989 WP_000098267.1.55070 WP_000098267.1.56358 WP_000098267.1.57150 WP_000098267.1.57348 WP_000098267.1.57395 WP_000098267.1.58136 WP_000098267.1.59165 WP_000098267.1.59226 WP_000098267.1.60342 WP_000098267.1.63350 WP_000098267.1.63554 WP_000098267.1.63612 WP_000098267.1.64153 WP_000098267.1.64793 WP_000098267.1.64930 WP_000098267.1.65484 WP_000098267.1.65662 WP_000098267.1.66059 WP_000098267.1.66978 WP_000098267.1.6701 WP_000098267.1.67412 WP_000098267.1.6897 WP_000098267.1.69404 WP_000098267.1.69868 WP_000098267.1.70191 WP_000098267.1.70251 WP_000098267.1.70341 WP_000098267.1.71158 WP_000098267.1.71724 WP_000098267.1.72342 WP_000098267.1.72449 WP_000098267.1.72698 WP_000098267.1.72748 WP_000098267.1.74509 WP_000098267.1.75124 WP_000098267.1.75505 WP_000098267.1.76447 WP_000098267.1.76460 WP_000098267.1.76957 WP_000098267.1.77198 WP_000098267.1.77813 WP_000098267.1.78041 WP_000098267.1.78377 WP_000098267.1.80061 WP_000098267.1.80463 WP_000098267.1.80966 WP_000098267.1.81582 WP_000098267.1.81876 WP_000098267.1.82507 WP_000098267.1.83286 WP_000098267.1.83321 WP_000098267.1.83340 WP_000098267.1.84164 WP_000098267.1.84986 WP_000098267.1.84990 WP_000098267.1.85008 WP_000098267.1.85416 WP_000098267.1.85969 WP_000098267.1.86483 WP_000098267.1.88735 WP_000098267.1.89630 WP_000098267.1.8985 WP_000098267.1.89998 WP_000098267.1.90314 WP_000098267.1.92123 WP_000098267.1.93023 WP_000098267.1.93605 WP_000098267.1.95254 WP_000098267.1.95712 WP_000098267.1.96128 WP_000098267.1.96608 WP_000098267.1.96680 WP_000098267.1.96769 WP_000098267.1.96932 WP_000098267.1.97279 WP_000098267.1.97798 WP_000098267.1.97815 WP_000098267.1.98323 WP_000098267.1.99119 gi|30064132|ref|NP_838303.1| gi|24114071|ref|NP_708581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]