SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 198466.SpyM3_0534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  198466.SpyM3_0534
Domain Number - Region: 46-142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.073
Family Voltage-gated potassium channels 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 198466.SpyM3_0534
Sequence length 162
Comment (Streptococcus pyogenes MGAS315)
Sequence
MIKLFGKIRYHWQPELSWSIIYWSIAFAPIFVGLSLLYERTEIPSRVFILFAIFAVLVGI
GLHRYFIIENNGILRIVSFELFGPRKLLISTITKIEVTKSTLCLHVEDKSYLFYMRKWPK
KYFLDALAVNPYFQGEVILSDNFIKLDYFEVYQHDKKALTRG
Download sequence
Identical sequences A0A0E1EP30 A0A0H2UTT3
193567.SPs1320 198466.SpyM3_0534 gi|28896232|ref|NP_802582.1| WP_011054347.1.11114 WP_011054347.1.12676 WP_011054347.1.13094 WP_011054347.1.13655 WP_011054347.1.16883 WP_011054347.1.17594 WP_011054347.1.17618 WP_011054347.1.22587 WP_011054347.1.23784 WP_011054347.1.23854 WP_011054347.1.26201 WP_011054347.1.26216 WP_011054347.1.27102 WP_011054347.1.29494 WP_011054347.1.30461 WP_011054347.1.31126 WP_011054347.1.34145 WP_011054347.1.34154 WP_011054347.1.3577 WP_011054347.1.35803 WP_011054347.1.36559 WP_011054347.1.41087 WP_011054347.1.42545 WP_011054347.1.47933 WP_011054347.1.49308 WP_011054347.1.51270 WP_011054347.1.51625 WP_011054347.1.5275 WP_011054347.1.52963 WP_011054347.1.53322 WP_011054347.1.53936 WP_011054347.1.55521 WP_011054347.1.59543 WP_011054347.1.60446 WP_011054347.1.62548 WP_011054347.1.62966 WP_011054347.1.6385 WP_011054347.1.64903 WP_011054347.1.66918 WP_011054347.1.67715 WP_011054347.1.67764 WP_011054347.1.71714 WP_011054347.1.72664 WP_011054347.1.7367 WP_011054347.1.74272 WP_011054347.1.74440 WP_011054347.1.74742 WP_011054347.1.74766 WP_011054347.1.75067 WP_011054347.1.77602 WP_011054347.1.81317 WP_011054347.1.81523 WP_011054347.1.84495 WP_011054347.1.86569 WP_011054347.1.87367 WP_011054347.1.89339 WP_011054347.1.89609 WP_011054347.1.92241 WP_011054347.1.92885 WP_011054347.1.95191 WP_011054347.1.95441 WP_011054347.1.97674 WP_011054347.1.99981 gi|21910070|ref|NP_664338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]