SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 199310.c1971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  199310.c1971
Domain Number 1 Region: 109-399
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-79
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 12-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.35e-34
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 199310.c1971
Sequence length 415
Comment (Escherichia coli CFT073)
Sequence
MHHDKRCKESNMKIVKAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELSVASYLQD
HLCPQLIGRDAHRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLL
GGASREGVMVYCHTTGHSIDEALDDYARHQELGFKAIRVQCGIPGMKTTYGMSKGKGLAY
EPATKGQWPEEQLWSTEKYLDFMPKLFDAVRNKFGFDEHLLHDMHHRLTPIEAARFGKSI
EDYRMFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLT
HAGGITGMRRIADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEYMGYSEQM
LEVFPHNWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYEPAYLPVARLEDGTLWNW
Download sequence
Identical sequences A0A0H2YYW8 A0A1X3KB41 Q1RBL8 Q8FHC7 V0VMB3
gi|386629268|ref|YP_006148988.1| gi|117623767|ref|YP_852680.1| 199310.c1971 364106.UTI89_C1768 405955.APECO1_664 gi|91210791|ref|YP_540777.1| gi|26247826|ref|NP_753866.1| gi|386634188|ref|YP_006153907.1| gi|222156335|ref|YP_002556474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]