SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 199310.c2084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  199310.c2084
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.57e-49
Family YdiL-like 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 199310.c2084
Sequence length 127
Comment (Escherichia coli CFT073)
Sequence
MFISCSHYTMNAYELQALRHIFAMTIDECATWIAQTGNSESWRQWENGKCAIPDCVVEQL
LAMRQQRKKHLHAIIEKINNRIGNNTMRFFPDLTAFQQVYPDGNFIDWKIYQSVAAELYA
HDLERLC
Download sequence
Identical sequences A0A0H2V7P9 Q1RBA7
gi|26247939|ref|NP_753979.1| gi|386599488|ref|YP_006100994.1| 199310.c2084 364106.UTI89_C1881 gi|386629380|ref|YP_006149100.1| gi|386634300|ref|YP_006154019.1| gi|91210902|ref|YP_540888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]