SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 199310.c3344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  199310.c3344
Domain Number 1 Region: 146-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.27e-207
Family Enolase 0.00000158
Further Details:      
 
Domain Number 2 Region: 3-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.04e-102
Family Enolase N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 199310.c3344
Sequence length 432
Comment (Escherichia coli CFT073)
Sequence
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
Download sequence
Identical sequences A0A017IAI7 A0A023Z1R6 A0A024KNM6 A0A025CW09 A0A026V981 A0A027U838 A0A028A6Q6 A0A028ECJ1 A0A029HL86 A0A029IL19 A0A062XWN2 A0A064TA36 A0A069XMC0 A0A070FDL9 A0A070SS52 A0A070UP91 A0A073FTG0 A0A073H5A6 A0A073UU81 A0A074HTI2 A0A080FMM4 A0A080IQ02 A0A090NEI4 A0A0A0FHG6 A0A0A8UHR6 A0A0E0U3N1 A0A0E0V8S4 A0A0E0XWL3 A0A0E1M0X5 A0A0E1SY16 A0A0E2LFJ8 A0A0E2TQG1 A0A0F6C895 A0A0F6FBF5 A0A0F6MGY7 A0A0G3KAV5 A0A0H3ENQ2 A0A0H3PMN9 A0A0I1LCH0 A0A0K9TFM4 A0A0M7NHR2 A0A0S3MZA3 A0A125WZ38 A0A127GNR9 A0A140N6G0 A0A142H5Z7 A0A181WUT2 A0A192CAD8 A0A1Q8P1A1 A0A1S6TEJ2 A0A1W2MML6 A0A1X3I1S4 A0A1X3II31 A0A1X3IWH5 A0A1X3JDN3 A0A1X3K575 A0A1X3KGS2 A0A1X3KZP7 A0A1X3LF62 A0A1X3LRS6 A0A1X3M6T9 A0A1Z3V0D4 A0A222QP47 A0A226KE66 A0A236MB03 A0A2D0NUC0 A0A2H1BIC6 A0A2I8CA40 A1AEW7 A7ZQM2 A8A3R4 B1EGL4 B1IU62 B1LQB2 B1XDI9 B2TZF4 B3X5L9 B5Z3E3 B6I6H5 B7LEJ8 B7LWP5 B7LXJ5 B7MLA0 B7MZ75 B7N715 B7NV69 B7UHJ5 C3SX72 C4ZZT2 C8UAB1 C8UEY7 D2AIL4 D3GSM8 D3QPX8 D6ICL0 D6JEB0 D7X6U4 D7XUA1 D7Y8U8 D7ZMQ1 D8A491 D8E1R1 E0J237 E1IQL4 E1J8A1 E2X9H6 E3PHT6 E3XIG2 E6BFZ6 E7SPZ2 E7SSI8 E7THX1 E9TML3 E9XHV2 E9YTK5 F0JRP5 F3V8W2 F4NJF5 F4SP43 F4TK44 F4V5C2 F4VHX9 F5N6D0 F5NYK0 G0F3V1 H4IF21 H4IVN5 H4JCB5 H4KL40 H4LG29 H4UN37 I0VU27 I2R9R2 I2S0G5 I2SM31 I2UED1 I2WJ69 I2XAQ3 I4SNG6 I6BGE1 I6CH77 I6D4F9 I6DTB6 I6FMC9 J7R4X1 K0XK14 K4US78 K4WKC0 L2VIG4 L2VNX0 L2XFK6 L3C5H4 L3P2P0 L3Q047 L3QFN3 L4V6J5 M9FPF0 P0A6P9 P0A6Q0 P0A6Q1 P0A6Q2 Q0TE80 Q1R7R4 Q31XL1 Q32CD6 R8X6U6 S0U0R2 S0VC42 S0WP89 S0XEX4 S0YJH0 S1C2Q5 S1CPV3 S1F1Z9 S1FUK2 S1GMU3 S1HY21 S1HZF6 S1LB08 S1PDA7 T5UMU9 T6AAV9 T6HC72 T6LPH9 T8J8B2 T9AZE0 T9S6C0 U9XDT0 U9XY83 U9YAH6 U9ZDF4 U9ZS80 V0SQ07 V0VLV6 V0Y752 V0YL77 V2RSF6 V2T9X4 V6FU64 V8F6H2 V8KD07 W0AXQ6 W1AP11 W1WQM5 W8ZMS2
gi|187733768|ref|YP_001881480.1| gi|443618811|ref|YP_007382667.1| gi|82778161|ref|YP_404510.1| gi|387613401|ref|YP_006116517.1| gi|291284108|ref|YP_003500926.1| gi|378711795|ref|YP_005276688.1| gi|170684207|ref|YP_001744941.1| gi|170082351|ref|YP_001731671.1| gi|218690902|ref|YP_002399114.1| gi|157158911|ref|YP_001464101.1| gi|260856889|ref|YP_003230780.1| gi|218696378|ref|YP_002404045.1| gi|471334398|ref|YP_007557875.1| gi|170018975|ref|YP_001723929.1| gi|251786053|ref|YP_003000357.1| gi|218555330|ref|YP_002388243.1| gi|26249182|ref|NP_755222.1| 3h8a_A 3h8a_B 3h8a_C 3h8a_D 5ohg_A 5ohg_B 5ohg_H 5ohg_I gi|386603168|ref|YP_006109468.1| gi|387622462|ref|YP_006130090.1| gi|386640261|ref|YP_006107059.1| gi|386635436|ref|YP_006155155.1| gi|560158735|ref|YP_008851450.1| gi|544577297|ref|YP_008572821.1| gi|110642920|ref|YP_670650.1| gi|82545078|ref|YP_409025.1| gi|387830625|ref|YP_003350562.1| gi|386615501|ref|YP_006135167.1| gi|218559767|ref|YP_002392680.1| gi|386620345|ref|YP_006139925.1| gi|387608418|ref|YP_006097274.1| gi|254794721|ref|YP_003079558.1| gi|117625008|ref|YP_853996.1| NP_311666.1.58667 NP_417259.1.90541 NP_708575.1.23235 WP_000036723.1.1000 WP_000036723.1.10001 WP_000036723.1.100014 WP_000036723.1.100044 WP_000036723.1.100052 WP_000036723.1.100066 WP_000036723.1.100073 WP_000036723.1.100085 WP_000036723.1.10010 WP_000036723.1.100111 WP_000036723.1.100116 WP_000036723.1.100138 WP_000036723.1.100151 WP_000036723.1.100159 WP_000036723.1.100185 WP_000036723.1.100194 WP_000036723.1.100220 WP_000036723.1.100227 WP_000036723.1.100251 WP_000036723.1.100252 WP_000036723.1.100281 WP_000036723.1.100283 WP_000036723.1.100285 WP_000036723.1.100299 WP_000036723.1.100302 WP_000036723.1.100304 WP_000036723.1.100306 WP_000036723.1.10034 WP_000036723.1.100346 WP_000036723.1.100425 WP_000036723.1.100441 WP_000036723.1.100444 WP_000036723.1.100447 WP_000036723.1.100451 WP_000036723.1.100474 WP_000036723.1.100487 WP_000036723.1.100496 WP_000036723.1.100499 WP_000036723.1.100508 WP_000036723.1.10051 WP_000036723.1.100531 WP_000036723.1.100543 WP_000036723.1.100554 WP_000036723.1.100571 WP_000036723.1.100573 WP_000036723.1.100614 WP_000036723.1.100667 WP_000036723.1.10067 WP_000036723.1.10068 WP_000036723.1.100685 WP_000036723.1.100688 WP_000036723.1.100689 WP_000036723.1.100718 WP_000036723.1.100735 WP_000036723.1.100738 WP_000036723.1.100752 WP_000036723.1.100753 WP_000036723.1.100758 WP_000036723.1.100778 WP_000036723.1.100796 WP_000036723.1.10080 WP_000036723.1.100803 WP_000036723.1.100824 WP_000036723.1.100836 WP_000036723.1.100851 WP_000036723.1.10086 WP_000036723.1.100867 WP_000036723.1.100868 WP_000036723.1.100898 WP_000036723.1.100916 WP_000036723.1.100925 WP_000036723.1.100928 WP_000036723.1.100933 WP_000036723.1.10094 WP_000036723.1.100950 WP_000036723.1.100959 WP_000036723.1.100966 WP_000036723.1.100990 WP_000036723.1.10100 WP_000036723.1.101033 WP_000036723.1.101087 WP_000036723.1.101096 WP_000036723.1.1011 WP_000036723.1.101102 WP_000036723.1.101105 WP_000036723.1.101110 WP_000036723.1.101148 WP_000036723.1.101152 WP_000036723.1.101157 WP_000036723.1.101158 WP_000036723.1.101166 WP_000036723.1.101186 WP_000036723.1.101214 WP_000036723.1.101216 WP_000036723.1.101255 WP_000036723.1.101257 WP_000036723.1.10126 WP_000036723.1.101282 WP_000036723.1.101289 WP_000036723.1.101293 WP_000036723.1.10131 WP_000036723.1.101313 WP_000036723.1.101359 WP_000036723.1.10138 WP_000036723.1.101387 WP_000036723.1.101399 WP_000036723.1.101423 WP_000036723.1.101429 WP_000036723.1.101430 WP_000036723.1.101436 WP_000036723.1.101439 WP_000036723.1.101468 WP_000036723.1.101518 WP_000036723.1.101522 WP_000036723.1.10154 WP_000036723.1.101545 WP_000036723.1.101583 WP_000036723.1.101586 WP_000036723.1.101628 WP_000036723.1.101630 WP_000036723.1.101651 WP_000036723.1.101653 WP_000036723.1.101654 WP_000036723.1.101667 WP_000036723.1.101668 WP_000036723.1.101686 WP_000036723.1.101693 WP_000036723.1.101694 WP_000036723.1.101700 WP_000036723.1.101727 WP_000036723.1.10173 WP_000036723.1.101737 WP_000036723.1.101747 WP_000036723.1.101769 WP_000036723.1.101786 WP_000036723.1.10181 WP_000036723.1.101822 WP_000036723.1.10184 WP_000036723.1.101840 WP_000036723.1.101845 WP_000036723.1.101855 WP_000036723.1.101865 WP_000036723.1.10187 WP_000036723.1.10188 WP_000036723.1.10190 WP_000036723.1.101900 WP_000036723.1.101908 WP_000036723.1.101913 WP_000036723.1.101926 WP_000036723.1.101932 WP_000036723.1.101935 WP_000036723.1.101947 WP_000036723.1.101948 WP_000036723.1.101952 WP_000036723.1.101962 WP_000036723.1.101964 WP_000036723.1.101969 WP_000036723.1.101977 WP_000036723.1.101984 WP_000036723.1.101987 WP_000036723.1.102021 WP_000036723.1.102036 WP_000036723.1.10206 WP_000036723.1.102069 WP_000036723.1.102076 WP_000036723.1.102094 WP_000036723.1.102104 WP_000036723.1.102106 WP_000036723.1.102122 WP_000036723.1.102139 WP_000036723.1.102144 WP_000036723.1.10222 WP_000036723.1.10226 WP_000036723.1.10233 WP_000036723.1.10235 WP_000036723.1.10252 WP_000036723.1.10273 WP_000036723.1.10304 WP_000036723.1.10326 WP_000036723.1.10335 WP_000036723.1.10361 WP_000036723.1.10381 WP_000036723.1.1040 WP_000036723.1.10400 WP_000036723.1.10417 WP_000036723.1.10461 WP_000036723.1.10476 WP_000036723.1.10491 WP_000036723.1.10492 WP_000036723.1.10496 WP_000036723.1.10524 WP_000036723.1.10538 WP_000036723.1.10569 WP_000036723.1.10573 WP_000036723.1.10579 WP_000036723.1.1058 WP_000036723.1.10605 WP_000036723.1.10607 WP_000036723.1.10651 WP_000036723.1.10673 WP_000036723.1.10697 WP_000036723.1.10705 WP_000036723.1.1071 WP_000036723.1.10715 WP_000036723.1.10729 WP_000036723.1.1073 WP_000036723.1.1074 WP_000036723.1.10744 WP_000036723.1.10748 WP_000036723.1.10761 WP_000036723.1.10763 WP_000036723.1.10786 WP_000036723.1.10787 WP_000036723.1.10798 WP_000036723.1.10809 WP_000036723.1.10814 WP_000036723.1.10824 WP_000036723.1.10833 WP_000036723.1.10842 WP_000036723.1.10849 WP_000036723.1.10869 WP_000036723.1.10922 WP_000036723.1.10940 WP_000036723.1.10970 WP_000036723.1.10988 WP_000036723.1.10989 WP_000036723.1.10994 WP_000036723.1.11006 WP_000036723.1.11032 WP_000036723.1.11047 WP_000036723.1.11052 WP_000036723.1.11057 WP_000036723.1.11068 WP_000036723.1.11071 WP_000036723.1.11091 WP_000036723.1.1111 WP_000036723.1.11118 WP_000036723.1.11121 WP_000036723.1.11133 WP_000036723.1.112 WP_000036723.1.11217 WP_000036723.1.1122 WP_000036723.1.11240 WP_000036723.1.11241 WP_000036723.1.11250 WP_000036723.1.11265 WP_000036723.1.11285 WP_000036723.1.11296 WP_000036723.1.11301 WP_000036723.1.11315 WP_000036723.1.11399 WP_000036723.1.11408 WP_000036723.1.1141 WP_000036723.1.11411 WP_000036723.1.11418 WP_000036723.1.11420 WP_000036723.1.11436 WP_000036723.1.11437 WP_000036723.1.11467 WP_000036723.1.11519 WP_000036723.1.11524 WP_000036723.1.11531 WP_000036723.1.11542 WP_000036723.1.11575 WP_000036723.1.11578 WP_000036723.1.11607 WP_000036723.1.11608 WP_000036723.1.11612 WP_000036723.1.11616 WP_000036723.1.11645 WP_000036723.1.11671 WP_000036723.1.11673 WP_000036723.1.1168 WP_000036723.1.11690 WP_000036723.1.11699 WP_000036723.1.11748 WP_000036723.1.11759 WP_000036723.1.1176 WP_000036723.1.11762 WP_000036723.1.11801 WP_000036723.1.11803 WP_000036723.1.11844 WP_000036723.1.1186 WP_000036723.1.11912 WP_000036723.1.11948 WP_000036723.1.11949 WP_000036723.1.11955 WP_000036723.1.11956 WP_000036723.1.1196 WP_000036723.1.11981 WP_000036723.1.11982 WP_000036723.1.11985 WP_000036723.1.12009 WP_000036723.1.12010 WP_000036723.1.12030 WP_000036723.1.12036 WP_000036723.1.12050 WP_000036723.1.12051 WP_000036723.1.12060 WP_000036723.1.12076 WP_000036723.1.12088 WP_000036723.1.12111 WP_000036723.1.12112 WP_000036723.1.12115 WP_000036723.1.1212 WP_000036723.1.12151 WP_000036723.1.12157 WP_000036723.1.12174 WP_000036723.1.1218 WP_000036723.1.12230 WP_000036723.1.12259 WP_000036723.1.12268 WP_000036723.1.12279 WP_000036723.1.12295 WP_000036723.1.12305 WP_000036723.1.12319 WP_000036723.1.12320 WP_000036723.1.12342 WP_000036723.1.12344 WP_000036723.1.12352 WP_000036723.1.12415 WP_000036723.1.1242 WP_000036723.1.12426 WP_000036723.1.12458 WP_000036723.1.12459 WP_000036723.1.12468 WP_000036723.1.12478 WP_000036723.1.12552 WP_000036723.1.12566 WP_000036723.1.12574 WP_000036723.1.12582 WP_000036723.1.12594 WP_000036723.1.12623 WP_000036723.1.12645 WP_000036723.1.12646 WP_000036723.1.12675 WP_000036723.1.12679 WP_000036723.1.12693 WP_000036723.1.12697 WP_000036723.1.127 WP_000036723.1.12709 WP_000036723.1.12717 WP_000036723.1.12743 WP_000036723.1.12749 WP_000036723.1.1275 WP_000036723.1.12756 WP_000036723.1.12761 WP_000036723.1.12762 WP_000036723.1.12763 WP_000036723.1.12766 WP_000036723.1.12775 WP_000036723.1.1278 WP_000036723.1.12781 WP_000036723.1.12826 WP_000036723.1.12830 WP_000036723.1.12831 WP_000036723.1.12876 WP_000036723.1.12893 WP_000036723.1.12911 WP_000036723.1.12914 WP_000036723.1.12915 WP_000036723.1.12917 WP_000036723.1.12944 WP_000036723.1.1295 WP_000036723.1.12956 WP_000036723.1.12965 WP_000036723.1.12976 WP_000036723.1.12979 WP_000036723.1.12987 WP_000036723.1.12991 WP_000036723.1.13002 WP_000036723.1.13015 WP_000036723.1.13031 WP_000036723.1.13060 WP_000036723.1.13074 WP_000036723.1.1308 WP_000036723.1.13117 WP_000036723.1.1312 WP_000036723.1.13136 WP_000036723.1.1314 WP_000036723.1.13144 WP_000036723.1.1315 WP_000036723.1.13157 WP_000036723.1.13162 WP_000036723.1.13176 WP_000036723.1.13181 WP_000036723.1.13205 WP_000036723.1.13217 WP_000036723.1.13222 WP_000036723.1.13223 WP_000036723.1.1323 WP_000036723.1.13239 WP_000036723.1.13252 WP_000036723.1.13258 WP_000036723.1.13271 WP_000036723.1.13272 WP_000036723.1.13278 WP_000036723.1.13281 WP_000036723.1.13290 WP_000036723.1.13295 WP_000036723.1.13301 WP_000036723.1.13332 WP_000036723.1.13333 WP_000036723.1.13348 WP_000036723.1.1335 WP_000036723.1.13393 WP_000036723.1.13409 WP_000036723.1.1343 WP_000036723.1.13430 WP_000036723.1.13437 WP_000036723.1.13442 WP_000036723.1.1345 WP_000036723.1.13451 WP_000036723.1.13469 WP_000036723.1.13473 WP_000036723.1.13481 WP_000036723.1.13492 WP_000036723.1.13495 WP_000036723.1.13525 WP_000036723.1.13585 WP_000036723.1.13601 WP_000036723.1.13608 WP_000036723.1.13618 WP_000036723.1.13624 WP_000036723.1.13626 WP_000036723.1.13644 WP_000036723.1.13656 WP_000036723.1.13662 WP_000036723.1.13664 WP_000036723.1.13672 WP_000036723.1.13778 WP_000036723.1.13791 WP_000036723.1.13798 WP_000036723.1.13824 WP_000036723.1.13867 WP_000036723.1.13877 WP_000036723.1.13881 WP_000036723.1.13891 WP_000036723.1.13924 WP_000036723.1.13934 WP_000036723.1.13936 WP_000036723.1.13939 WP_000036723.1.13944 WP_000036723.1.13949 WP_000036723.1.13974 WP_000036723.1.13979 WP_000036723.1.14023 WP_000036723.1.14030 WP_000036723.1.14042 WP_000036723.1.14058 WP_000036723.1.14062 WP_000036723.1.14070 WP_000036723.1.14110 WP_000036723.1.14129 WP_000036723.1.14144 WP_000036723.1.14164 WP_000036723.1.1419 WP_000036723.1.14245 WP_000036723.1.14253 WP_000036723.1.14277 WP_000036723.1.14292 WP_000036723.1.14304 WP_000036723.1.14322 WP_000036723.1.14331 WP_000036723.1.14346 WP_000036723.1.14371 WP_000036723.1.1438 WP_000036723.1.14389 WP_000036723.1.1439 WP_000036723.1.14432 WP_000036723.1.14445 WP_000036723.1.14453 WP_000036723.1.14468 WP_000036723.1.14493 WP_000036723.1.14501 WP_000036723.1.14506 WP_000036723.1.14508 WP_000036723.1.14509 WP_000036723.1.14529 WP_000036723.1.14536 WP_000036723.1.14538 WP_000036723.1.14581 WP_000036723.1.14582 WP_000036723.1.14600 WP_000036723.1.14601 WP_000036723.1.14605 WP_000036723.1.14607 WP_000036723.1.1461 WP_000036723.1.14616 WP_000036723.1.14621 WP_000036723.1.14661 WP_000036723.1.14672 WP_000036723.1.14678 WP_000036723.1.14687 WP_000036723.1.14693 WP_000036723.1.1470 WP_000036723.1.14711 WP_000036723.1.14712 WP_000036723.1.14746 WP_000036723.1.14748 WP_000036723.1.14749 WP_000036723.1.14811 WP_000036723.1.14833 WP_000036723.1.1486 WP_000036723.1.14871 WP_000036723.1.14879 WP_000036723.1.14914 WP_000036723.1.14934 WP_000036723.1.14946 WP_000036723.1.14956 WP_000036723.1.14958 WP_000036723.1.14977 WP_000036723.1.14992 WP_000036723.1.14993 WP_000036723.1.15020 WP_000036723.1.15041 WP_000036723.1.15068 WP_000036723.1.1508 WP_000036723.1.15087 WP_000036723.1.15090 WP_000036723.1.1510 WP_000036723.1.15117 WP_000036723.1.1512 WP_000036723.1.15121 WP_000036723.1.15138 WP_000036723.1.15177 WP_000036723.1.15193 WP_000036723.1.15207 WP_000036723.1.15221 WP_000036723.1.1524 WP_000036723.1.15245 WP_000036723.1.15252 WP_000036723.1.15259 WP_000036723.1.15270 WP_000036723.1.15274 WP_000036723.1.15277 WP_000036723.1.15282 WP_000036723.1.15287 WP_000036723.1.15290 WP_000036723.1.153 WP_000036723.1.15300 WP_000036723.1.15304 WP_000036723.1.15332 WP_000036723.1.15335 WP_000036723.1.15347 WP_000036723.1.15356 WP_000036723.1.15377 WP_000036723.1.15416 WP_000036723.1.15420 WP_000036723.1.1543 WP_000036723.1.15444 WP_000036723.1.15453 WP_000036723.1.15469 WP_000036723.1.15496 WP_000036723.1.1550 WP_000036723.1.15503 WP_000036723.1.15521 WP_000036723.1.15527 WP_000036723.1.15528 WP_000036723.1.15538 WP_000036723.1.15576 WP_000036723.1.15583 WP_000036723.1.1559 WP_000036723.1.15593 WP_000036723.1.15600 WP_000036723.1.1561 WP_000036723.1.15620 WP_000036723.1.15624 WP_000036723.1.15626 WP_000036723.1.15645 WP_000036723.1.15654 WP_000036723.1.15702 WP_000036723.1.15707 WP_000036723.1.15731 WP_000036723.1.15740 WP_000036723.1.15747 WP_000036723.1.15752 WP_000036723.1.15762 WP_000036723.1.15767 WP_000036723.1.15768 WP_000036723.1.15782 WP_000036723.1.15791 WP_000036723.1.15809 WP_000036723.1.1582 WP_000036723.1.15855 WP_000036723.1.15857 WP_000036723.1.15863 WP_000036723.1.15869 WP_000036723.1.1588 WP_000036723.1.15906 WP_000036723.1.15916 WP_000036723.1.15945 WP_000036723.1.15949 WP_000036723.1.15951 WP_000036723.1.15983 WP_000036723.1.15984 WP_000036723.1.15990 WP_000036723.1.16010 WP_000036723.1.16014 WP_000036723.1.16034 WP_000036723.1.1604 WP_000036723.1.16042 WP_000036723.1.16067 WP_000036723.1.16075 WP_000036723.1.16086 WP_000036723.1.16087 WP_000036723.1.1609 WP_000036723.1.16102 WP_000036723.1.16111 WP_000036723.1.16117 WP_000036723.1.16131 WP_000036723.1.16133 WP_000036723.1.16154 WP_000036723.1.16171 WP_000036723.1.16175 WP_000036723.1.16179 WP_000036723.1.16183 WP_000036723.1.16194 WP_000036723.1.1622 WP_000036723.1.16222 WP_000036723.1.16270 WP_000036723.1.16272 WP_000036723.1.16294 WP_000036723.1.163 WP_000036723.1.16322 WP_000036723.1.1634 WP_000036723.1.16387 WP_000036723.1.16388 WP_000036723.1.16396 WP_000036723.1.1640 WP_000036723.1.16435 WP_000036723.1.16463 WP_000036723.1.16481 WP_000036723.1.16482 WP_000036723.1.16500 WP_000036723.1.16517 WP_000036723.1.16532 WP_000036723.1.16539 WP_000036723.1.16541 WP_000036723.1.1655 WP_000036723.1.16577 WP_000036723.1.16592 WP_000036723.1.16608 WP_000036723.1.16612 WP_000036723.1.16648 WP_000036723.1.16667 WP_000036723.1.16682 WP_000036723.1.16685 WP_000036723.1.16700 WP_000036723.1.16705 WP_000036723.1.16715 WP_000036723.1.16721 WP_000036723.1.1673 WP_000036723.1.16745 WP_000036723.1.16752 WP_000036723.1.16766 WP_000036723.1.16780 WP_000036723.1.16798 WP_000036723.1.16799 WP_000036723.1.16805 WP_000036723.1.16807 WP_000036723.1.16818 WP_000036723.1.16843 WP_000036723.1.16845 WP_000036723.1.16861 WP_000036723.1.16862 WP_000036723.1.16927 WP_000036723.1.16979 WP_000036723.1.16992 WP_000036723.1.17014 WP_000036723.1.17017 WP_000036723.1.17018 WP_000036723.1.17028 WP_000036723.1.17061 WP_000036723.1.17084 WP_000036723.1.17087 WP_000036723.1.1710 WP_000036723.1.17101 WP_000036723.1.17102 WP_000036723.1.17109 WP_000036723.1.17111 WP_000036723.1.17114 WP_000036723.1.17119 WP_000036723.1.17123 WP_000036723.1.17150 WP_000036723.1.17153 WP_000036723.1.17170 WP_000036723.1.17172 WP_000036723.1.17182 WP_000036723.1.17187 WP_000036723.1.17206 WP_000036723.1.17216 WP_000036723.1.17241 WP_000036723.1.17242 WP_000036723.1.17267 WP_000036723.1.17282 WP_000036723.1.17290 WP_000036723.1.17297 WP_000036723.1.1731 WP_000036723.1.17325 WP_000036723.1.17333 WP_000036723.1.17356 WP_000036723.1.17360 WP_000036723.1.17373 WP_000036723.1.17386 WP_000036723.1.17387 WP_000036723.1.17389 WP_000036723.1.17392 WP_000036723.1.17403 WP_000036723.1.17410 WP_000036723.1.17415 WP_000036723.1.17417 WP_000036723.1.17432 WP_000036723.1.17461 WP_000036723.1.17464 WP_000036723.1.17496 WP_000036723.1.17515 WP_000036723.1.17534 WP_000036723.1.1754 WP_000036723.1.1755 WP_000036723.1.17550 WP_000036723.1.17568 WP_000036723.1.17577 WP_000036723.1.17584 WP_000036723.1.17595 WP_000036723.1.17623 WP_000036723.1.1763 WP_000036723.1.17637 WP_000036723.1.1766 WP_000036723.1.17680 WP_000036723.1.1769 WP_000036723.1.17701 WP_000036723.1.17711 WP_000036723.1.1772 WP_000036723.1.17734 WP_000036723.1.17757 WP_000036723.1.17766 WP_000036723.1.17769 WP_000036723.1.1778 WP_000036723.1.17802 WP_000036723.1.17829 WP_000036723.1.17831 WP_000036723.1.17849 WP_000036723.1.17889 WP_000036723.1.17904 WP_000036723.1.17920 WP_000036723.1.17925 WP_000036723.1.17937 WP_000036723.1.17952 WP_000036723.1.17961 WP_000036723.1.17963 WP_000036723.1.17984 WP_000036723.1.18000 WP_000036723.1.18006 WP_000036723.1.1802 WP_000036723.1.18024 WP_000036723.1.18050 WP_000036723.1.18064 WP_000036723.1.18094 WP_000036723.1.18112 WP_000036723.1.18118 WP_000036723.1.18121 WP_000036723.1.18133 WP_000036723.1.18134 WP_000036723.1.18136 WP_000036723.1.18141 WP_000036723.1.18164 WP_000036723.1.18175 WP_000036723.1.1821 WP_000036723.1.18225 WP_000036723.1.18226 WP_000036723.1.18229 WP_000036723.1.18275 WP_000036723.1.18316 WP_000036723.1.18326 WP_000036723.1.18329 WP_000036723.1.18337 WP_000036723.1.18338 WP_000036723.1.1834 WP_000036723.1.18340 WP_000036723.1.18348 WP_000036723.1.18381 WP_000036723.1.18383 WP_000036723.1.18394 WP_000036723.1.18402 WP_000036723.1.18410 WP_000036723.1.18420 WP_000036723.1.18428 WP_000036723.1.18436 WP_000036723.1.18438 WP_000036723.1.1844 WP_000036723.1.18458 WP_000036723.1.18461 WP_000036723.1.18472 WP_000036723.1.18482 WP_000036723.1.18530 WP_000036723.1.18550 WP_000036723.1.18556 WP_000036723.1.18581 WP_000036723.1.18588 WP_000036723.1.1861 WP_000036723.1.18617 WP_000036723.1.18649 WP_000036723.1.18650 WP_000036723.1.18651 WP_000036723.1.18655 WP_000036723.1.1866 WP_000036723.1.18666 WP_000036723.1.1867 WP_000036723.1.18675 WP_000036723.1.18699 WP_000036723.1.18714 WP_000036723.1.18725 WP_000036723.1.18726 WP_000036723.1.1873 WP_000036723.1.18734 WP_000036723.1.18794 WP_000036723.1.188 WP_000036723.1.18801 WP_000036723.1.18802 WP_000036723.1.1881 WP_000036723.1.18828 WP_000036723.1.18837 WP_000036723.1.18843 WP_000036723.1.18861 WP_000036723.1.18874 WP_000036723.1.18876 WP_000036723.1.18899 WP_000036723.1.18908 WP_000036723.1.18929 WP_000036723.1.18934 WP_000036723.1.18936 WP_000036723.1.1896 WP_000036723.1.18962 WP_000036723.1.18966 WP_000036723.1.18983 WP_000036723.1.18995 WP_000036723.1.19024 WP_000036723.1.1903 WP_000036723.1.19036 WP_000036723.1.19039 WP_000036723.1.1906 WP_000036723.1.19075 WP_000036723.1.1909 WP_000036723.1.19090 WP_000036723.1.191 WP_000036723.1.19100 WP_000036723.1.19114 WP_000036723.1.19129 WP_000036723.1.19135 WP_000036723.1.19140 WP_000036723.1.19146 WP_000036723.1.19147 WP_000036723.1.19148 WP_000036723.1.1915 WP_000036723.1.19150 WP_000036723.1.19153 WP_000036723.1.19171 WP_000036723.1.19194 WP_000036723.1.19205 WP_000036723.1.19206 WP_000036723.1.19245 WP_000036723.1.1925 WP_000036723.1.19276 WP_000036723.1.19277 WP_000036723.1.19297 WP_000036723.1.193 WP_000036723.1.19312 WP_000036723.1.19313 WP_000036723.1.19314 WP_000036723.1.19315 WP_000036723.1.19332 WP_000036723.1.19347 WP_000036723.1.19350 WP_000036723.1.19361 WP_000036723.1.19374 WP_000036723.1.19379 WP_000036723.1.19389 WP_000036723.1.19419 WP_000036723.1.19424 WP_000036723.1.19441 WP_000036723.1.19448 WP_000036723.1.19453 WP_000036723.1.19465 WP_000036723.1.19478 WP_000036723.1.19492 WP_000036723.1.19494 WP_000036723.1.1952 WP_000036723.1.19534 WP_000036723.1.19544 WP_000036723.1.19545 WP_000036723.1.19547 WP_000036723.1.19557 WP_000036723.1.19581 WP_000036723.1.19583 WP_000036723.1.19593 WP_000036723.1.1960 WP_000036723.1.19602 WP_000036723.1.19612 WP_000036723.1.1963 WP_000036723.1.19644 WP_000036723.1.19649 WP_000036723.1.19651 WP_000036723.1.19654 WP_000036723.1.19655 WP_000036723.1.19661 WP_000036723.1.19684 WP_000036723.1.19691 WP_000036723.1.19761 WP_000036723.1.19778 WP_000036723.1.19795 WP_000036723.1.1982 WP_000036723.1.19830 WP_000036723.1.19840 WP_000036723.1.19847 WP_000036723.1.19861 WP_000036723.1.1987 WP_000036723.1.19878 WP_000036723.1.19889 WP_000036723.1.19940 WP_000036723.1.19957 WP_000036723.1.19972 WP_000036723.1.19994 WP_000036723.1.2005 WP_000036723.1.20114 WP_000036723.1.20115 WP_000036723.1.20129 WP_000036723.1.20133 WP_000036723.1.20136 WP_000036723.1.2015 WP_000036723.1.20151 WP_000036723.1.20157 WP_000036723.1.20159 WP_000036723.1.20164 WP_000036723.1.20166 WP_000036723.1.20170 WP_000036723.1.20178 WP_000036723.1.20183 WP_000036723.1.20215 WP_000036723.1.20224 WP_000036723.1.20238 WP_000036723.1.20251 WP_000036723.1.20264 WP_000036723.1.2027 WP_000036723.1.20277 WP_000036723.1.20289 WP_000036723.1.20308 WP_000036723.1.20318 WP_000036723.1.20325 WP_000036723.1.20331 WP_000036723.1.20334 WP_000036723.1.20388 WP_000036723.1.20442 WP_000036723.1.20445 WP_000036723.1.20449 WP_000036723.1.20452 WP_000036723.1.20480 WP_000036723.1.20483 WP_000036723.1.20484 WP_000036723.1.20493 WP_000036723.1.20506 WP_000036723.1.20515 WP_000036723.1.20519 WP_000036723.1.20536 WP_000036723.1.20546 WP_000036723.1.20549 WP_000036723.1.20565 WP_000036723.1.20575 WP_000036723.1.20594 WP_000036723.1.20596 WP_000036723.1.2063 WP_000036723.1.20630 WP_000036723.1.20638 WP_000036723.1.20640 WP_000036723.1.20662 WP_000036723.1.20691 WP_000036723.1.20709 WP_000036723.1.20724 WP_000036723.1.20730 WP_000036723.1.20737 WP_000036723.1.20741 WP_000036723.1.20745 WP_000036723.1.2075 WP_000036723.1.20761 WP_000036723.1.20765 WP_000036723.1.20784 WP_000036723.1.20785 WP_000036723.1.20803 WP_000036723.1.20813 WP_000036723.1.20818 WP_000036723.1.20824 WP_000036723.1.20841 WP_000036723.1.20848 WP_000036723.1.20863 WP_000036723.1.2089 WP_000036723.1.20893 WP_000036723.1.20907 WP_000036723.1.20933 WP_000036723.1.2094 WP_000036723.1.20941 WP_000036723.1.20943 WP_000036723.1.20950 WP_000036723.1.20958 WP_000036723.1.20962 WP_000036723.1.20982 WP_000036723.1.20989 WP_000036723.1.2100 WP_000036723.1.21017 WP_000036723.1.21020 WP_000036723.1.21024 WP_000036723.1.21029 WP_000036723.1.21033 WP_000036723.1.21041 WP_000036723.1.21057 WP_000036723.1.21104 WP_000036723.1.21122 WP_000036723.1.21137 WP_000036723.1.21152 WP_000036723.1.21236 WP_000036723.1.21248 WP_000036723.1.21251 WP_000036723.1.21255 WP_000036723.1.21266 WP_000036723.1.21277 WP_000036723.1.21320 WP_000036723.1.21336 WP_000036723.1.21378 WP_000036723.1.2142 WP_000036723.1.21441 WP_000036723.1.21450 WP_000036723.1.21455 WP_000036723.1.21470 WP_000036723.1.21508 WP_000036723.1.21519 WP_000036723.1.21526 WP_000036723.1.21537 WP_000036723.1.2156 WP_000036723.1.21573 WP_000036723.1.21578 WP_000036723.1.21596 WP_000036723.1.21614 WP_000036723.1.21628 WP_000036723.1.21634 WP_000036723.1.21637 WP_000036723.1.2164 WP_000036723.1.21652 WP_000036723.1.21656 WP_000036723.1.21661 WP_000036723.1.21666 WP_000036723.1.21667 WP_000036723.1.21668 WP_000036723.1.21696 WP_000036723.1.21714 WP_000036723.1.21729 WP_000036723.1.21732 WP_000036723.1.21733 WP_000036723.1.21756 WP_000036723.1.21758 WP_000036723.1.21771 WP_000036723.1.21773 WP_000036723.1.21812 WP_000036723.1.21823 WP_000036723.1.21887 WP_000036723.1.21895 WP_000036723.1.21899 WP_000036723.1.21915 WP_000036723.1.21948 WP_000036723.1.21962 WP_000036723.1.2198 WP_000036723.1.21986 WP_000036723.1.21992 WP_000036723.1.22021 WP_000036723.1.22042 WP_000036723.1.22060 WP_000036723.1.22088 WP_000036723.1.22098 WP_000036723.1.22113 WP_000036723.1.22138 WP_000036723.1.22161 WP_000036723.1.2218 WP_000036723.1.22189 WP_000036723.1.22195 WP_000036723.1.22203 WP_000036723.1.22204 WP_000036723.1.22251 WP_000036723.1.22269 WP_000036723.1.22272 WP_000036723.1.22280 WP_000036723.1.22291 WP_000036723.1.22293 WP_000036723.1.22295 WP_000036723.1.22304 WP_000036723.1.22314 WP_000036723.1.22325 WP_000036723.1.22328 WP_000036723.1.22350 WP_000036723.1.22359 WP_000036723.1.22363 WP_000036723.1.22381 WP_000036723.1.22409 WP_000036723.1.2242 WP_000036723.1.22431 WP_000036723.1.2245 WP_000036723.1.22450 WP_000036723.1.22464 WP_000036723.1.22494 WP_000036723.1.22508 WP_000036723.1.22522 WP_000036723.1.22543 WP_000036723.1.22544 WP_000036723.1.22571 WP_000036723.1.22572 WP_000036723.1.22574 WP_000036723.1.22576 WP_000036723.1.22579 WP_000036723.1.22594 WP_000036723.1.22599 WP_000036723.1.22602 WP_000036723.1.22631 WP_000036723.1.22632 WP_000036723.1.22649 WP_000036723.1.22662 WP_000036723.1.22667 WP_000036723.1.22669 WP_000036723.1.22685 WP_000036723.1.22690 WP_000036723.1.22691 WP_000036723.1.22743 WP_000036723.1.22756 WP_000036723.1.22757 WP_000036723.1.22759 WP_000036723.1.22765 WP_000036723.1.22771 WP_000036723.1.22777 WP_000036723.1.22783 WP_000036723.1.22814 WP_000036723.1.22824 WP_000036723.1.22830 WP_000036723.1.22868 WP_000036723.1.22875 WP_000036723.1.22878 WP_000036723.1.22885 WP_000036723.1.22896 WP_000036723.1.22908 WP_000036723.1.22917 WP_000036723.1.22925 WP_000036723.1.22939 WP_000036723.1.22988 WP_000036723.1.22993 WP_000036723.1.2300 WP_000036723.1.23005 WP_000036723.1.23021 WP_000036723.1.23026 WP_000036723.1.23035 WP_000036723.1.23042 WP_000036723.1.23044 WP_000036723.1.23045 WP_000036723.1.23073 WP_000036723.1.23078 WP_000036723.1.23090 WP_000036723.1.23092 WP_000036723.1.23105 WP_000036723.1.23109 WP_000036723.1.23115 WP_000036723.1.23135 WP_000036723.1.2322 WP_000036723.1.23230 WP_000036723.1.23241 WP_000036723.1.2325 WP_000036723.1.23282 WP_000036723.1.23285 WP_000036723.1.23290 WP_000036723.1.23299 WP_000036723.1.23323 WP_000036723.1.23330 WP_000036723.1.23351 WP_000036723.1.23355 WP_000036723.1.23376 WP_000036723.1.23378 WP_000036723.1.23383 WP_000036723.1.23386 WP_000036723.1.23388 WP_000036723.1.23393 WP_000036723.1.23435 WP_000036723.1.23463 WP_000036723.1.23467 WP_000036723.1.23486 WP_000036723.1.23487 WP_000036723.1.23511 WP_000036723.1.23520 WP_000036723.1.23522 WP_000036723.1.23527 WP_000036723.1.23549 WP_000036723.1.23575 WP_000036723.1.23593 WP_000036723.1.2362 WP_000036723.1.23622 WP_000036723.1.23625 WP_000036723.1.23640 WP_000036723.1.23676 WP_000036723.1.23686 WP_000036723.1.23693 WP_000036723.1.23700 WP_000036723.1.23711 WP_000036723.1.23724 WP_000036723.1.23741 WP_000036723.1.23752 WP_000036723.1.23754 WP_000036723.1.23765 WP_000036723.1.23790 WP_000036723.1.23804 WP_000036723.1.23806 WP_000036723.1.23812 WP_000036723.1.23838 WP_000036723.1.23840 WP_000036723.1.23855 WP_000036723.1.23869 WP_000036723.1.2388 WP_000036723.1.23890 WP_000036723.1.23895 WP_000036723.1.23898 WP_000036723.1.23899 WP_000036723.1.23914 WP_000036723.1.23915 WP_000036723.1.23945 WP_000036723.1.2395 WP_000036723.1.23950 WP_000036723.1.23953 WP_000036723.1.23960 WP_000036723.1.23962 WP_000036723.1.23970 WP_000036723.1.23973 WP_000036723.1.23984 WP_000036723.1.23985 WP_000036723.1.24004 WP_000036723.1.24024 WP_000036723.1.24045 WP_000036723.1.24068 WP_000036723.1.24070 WP_000036723.1.24088 WP_000036723.1.24089 WP_000036723.1.24122 WP_000036723.1.24124 WP_000036723.1.24127 WP_000036723.1.2413 WP_000036723.1.24136 WP_000036723.1.24169 WP_000036723.1.24170 WP_000036723.1.24177 WP_000036723.1.24194 WP_000036723.1.24233 WP_000036723.1.24278 WP_000036723.1.2428 WP_000036723.1.24283 WP_000036723.1.2430 WP_000036723.1.24304 WP_000036723.1.24316 WP_000036723.1.2433 WP_000036723.1.24341 WP_000036723.1.24362 WP_000036723.1.24374 WP_000036723.1.24381 WP_000036723.1.24383 WP_000036723.1.24458 WP_000036723.1.24460 WP_000036723.1.24473 WP_000036723.1.24483 WP_000036723.1.24485 WP_000036723.1.2449 WP_000036723.1.24499 WP_000036723.1.24523 WP_000036723.1.24524 WP_000036723.1.24536 WP_000036723.1.24547 WP_000036723.1.24575 WP_000036723.1.24577 WP_000036723.1.24583 WP_000036723.1.24592 WP_000036723.1.24616 WP_000036723.1.24634 WP_000036723.1.24641 WP_000036723.1.24642 WP_000036723.1.24646 WP_000036723.1.24650 WP_000036723.1.2469 WP_000036723.1.24693 WP_000036723.1.24695 WP_000036723.1.24703 WP_000036723.1.24752 WP_000036723.1.24753 WP_000036723.1.24758 WP_000036723.1.24763 WP_000036723.1.2479 WP_000036723.1.24797 WP_000036723.1.24799 WP_000036723.1.24808 WP_000036723.1.24849 WP_000036723.1.24870 WP_000036723.1.24876 WP_000036723.1.24899 WP_000036723.1.24902 WP_000036723.1.24906 WP_000036723.1.24909 WP_000036723.1.24926 WP_000036723.1.24929 WP_000036723.1.24939 WP_000036723.1.24946 WP_000036723.1.24960 WP_000036723.1.24968 WP_000036723.1.24979 WP_000036723.1.24984 WP_000036723.1.25019 WP_000036723.1.2502 WP_000036723.1.25021 WP_000036723.1.25038 WP_000036723.1.25039 WP_000036723.1.2504 WP_000036723.1.25042 WP_000036723.1.25050 WP_000036723.1.25076 WP_000036723.1.25079 WP_000036723.1.25082 WP_000036723.1.25085 WP_000036723.1.25086 WP_000036723.1.25087 WP_000036723.1.25088 WP_000036723.1.2512 WP_000036723.1.25126 WP_000036723.1.25141 WP_000036723.1.25174 WP_000036723.1.25183 WP_000036723.1.25193 WP_000036723.1.25201 WP_000036723.1.25203 WP_000036723.1.25204 WP_000036723.1.25248 WP_000036723.1.25270 WP_000036723.1.25272 WP_000036723.1.25305 WP_000036723.1.2531 WP_000036723.1.25312 WP_000036723.1.25324 WP_000036723.1.2537 WP_000036723.1.25372 WP_000036723.1.25378 WP_000036723.1.25380 WP_000036723.1.2540 WP_000036723.1.25414 WP_000036723.1.25420 WP_000036723.1.2543 WP_000036723.1.25446 WP_000036723.1.25480 WP_000036723.1.255 WP_000036723.1.25525 WP_000036723.1.25526 WP_000036723.1.25548 WP_000036723.1.25577 WP_000036723.1.2558 WP_000036723.1.25592 WP_000036723.1.25612 WP_000036723.1.25613 WP_000036723.1.25631 WP_000036723.1.25643 WP_000036723.1.25652 WP_000036723.1.2567 WP_000036723.1.25680 WP_000036723.1.25681 WP_000036723.1.25712 WP_000036723.1.25713 WP_000036723.1.25724 WP_000036723.1.25726 WP_000036723.1.25750 WP_000036723.1.25755 WP_000036723.1.25794 WP_000036723.1.25799 WP_000036723.1.25819 WP_000036723.1.25831 WP_000036723.1.25832 WP_000036723.1.25843 WP_000036723.1.25869 WP_000036723.1.25873 WP_000036723.1.2588 WP_000036723.1.25886 WP_000036723.1.25890 WP_000036723.1.25895 WP_000036723.1.25945 WP_000036723.1.2597 WP_000036723.1.25996 WP_000036723.1.26005 WP_000036723.1.26040 WP_000036723.1.26048 WP_000036723.1.26055 WP_000036723.1.2606 WP_000036723.1.26061 WP_000036723.1.26066 WP_000036723.1.26076 WP_000036723.1.26100 WP_000036723.1.26105 WP_000036723.1.2612 WP_000036723.1.26121 WP_000036723.1.26125 WP_000036723.1.26130 WP_000036723.1.26131 WP_000036723.1.26134 WP_000036723.1.26150 WP_000036723.1.26161 WP_000036723.1.26175 WP_000036723.1.26186 WP_000036723.1.26189 WP_000036723.1.26191 WP_000036723.1.26196 WP_000036723.1.26246 WP_000036723.1.26259 WP_000036723.1.26262 WP_000036723.1.26264 WP_000036723.1.26270 WP_000036723.1.26284 WP_000036723.1.26304 WP_000036723.1.26325 WP_000036723.1.26331 WP_000036723.1.2637 WP_000036723.1.26379 WP_000036723.1.26391 WP_000036723.1.26398 WP_000036723.1.26401 WP_000036723.1.26403 WP_000036723.1.26419 WP_000036723.1.2642 WP_000036723.1.26438 WP_000036723.1.26443 WP_000036723.1.26467 WP_000036723.1.26474 WP_000036723.1.26479 WP_000036723.1.26480 WP_000036723.1.26517 WP_000036723.1.26525 WP_000036723.1.26569 WP_000036723.1.26574 WP_000036723.1.26575 WP_000036723.1.26579 WP_000036723.1.26588 WP_000036723.1.26590 WP_000036723.1.26598 WP_000036723.1.26609 WP_000036723.1.26613 WP_000036723.1.26627 WP_000036723.1.26644 WP_000036723.1.2665 WP_000036723.1.26658 WP_000036723.1.26659 WP_000036723.1.26660 WP_000036723.1.26683 WP_000036723.1.26688 WP_000036723.1.26716 WP_000036723.1.26720 WP_000036723.1.26736 WP_000036723.1.26761 WP_000036723.1.26782 WP_000036723.1.26837 WP_000036723.1.26839 WP_000036723.1.26861 WP_000036723.1.26878 WP_000036723.1.2688 WP_000036723.1.26912 WP_000036723.1.26932 WP_000036723.1.2694 WP_000036723.1.26941 WP_000036723.1.26943 WP_000036723.1.2695 WP_000036723.1.26950 WP_000036723.1.26975 WP_000036723.1.26987 WP_000036723.1.26995 WP_000036723.1.26998 WP_000036723.1.2700 WP_000036723.1.27019 WP_000036723.1.27043 WP_000036723.1.27057 WP_000036723.1.27060 WP_000036723.1.27091 WP_000036723.1.27098 WP_000036723.1.27101 WP_000036723.1.2712 WP_000036723.1.27134 WP_000036723.1.27141 WP_000036723.1.27148 WP_000036723.1.27175 WP_000036723.1.27188 WP_000036723.1.27214 WP_000036723.1.27234 WP_000036723.1.27260 WP_000036723.1.27280 WP_000036723.1.27283 WP_000036723.1.27287 WP_000036723.1.27292 WP_000036723.1.2731 WP_000036723.1.27310 WP_000036723.1.27313 WP_000036723.1.27330 WP_000036723.1.27338 WP_000036723.1.27367 WP_000036723.1.27373 WP_000036723.1.27396 WP_000036723.1.27401 WP_000036723.1.27424 WP_000036723.1.27426 WP_000036723.1.27445 WP_000036723.1.2745 WP_000036723.1.27451 WP_000036723.1.27472 WP_000036723.1.27504 WP_000036723.1.27518 WP_000036723.1.27520 WP_000036723.1.27524 WP_000036723.1.2755 WP_000036723.1.27560 WP_000036723.1.27580 WP_000036723.1.27585 WP_000036723.1.27611 WP_000036723.1.27618 WP_000036723.1.27691 WP_000036723.1.27693 WP_000036723.1.27698 WP_000036723.1.27723 WP_000036723.1.27734 WP_000036723.1.27741 WP_000036723.1.27742 WP_000036723.1.27749 WP_000036723.1.27758 WP_000036723.1.27774 WP_000036723.1.2779 WP_000036723.1.27797 WP_000036723.1.2782 WP_000036723.1.27846 WP_000036723.1.27856 WP_000036723.1.27861 WP_000036723.1.27871 WP_000036723.1.27876 WP_000036723.1.27879 WP_000036723.1.27897 WP_000036723.1.27911 WP_000036723.1.27913 WP_000036723.1.27923 WP_000036723.1.27932 WP_000036723.1.2794 WP_000036723.1.27957 WP_000036723.1.27971 WP_000036723.1.27998 WP_000036723.1.28008 WP_000036723.1.28026 WP_000036723.1.28027 WP_000036723.1.28046 WP_000036723.1.28051 WP_000036723.1.28102 WP_000036723.1.28109 WP_000036723.1.2811 WP_000036723.1.28110 WP_000036723.1.28128 WP_000036723.1.28143 WP_000036723.1.28145 WP_000036723.1.28156 WP_000036723.1.28167 WP_000036723.1.28184 WP_000036723.1.28199 WP_000036723.1.2823 WP_000036723.1.28250 WP_000036723.1.2826 WP_000036723.1.28268 WP_000036723.1.28271 WP_000036723.1.28305 WP_000036723.1.28314 WP_000036723.1.28318 WP_000036723.1.28322 WP_000036723.1.28345 WP_000036723.1.28349 WP_000036723.1.28371 WP_000036723.1.2838 WP_000036723.1.28401 WP_000036723.1.28440 WP_000036723.1.28461 WP_000036723.1.28476 WP_000036723.1.28480 WP_000036723.1.28491 WP_000036723.1.28496 WP_000036723.1.285 WP_000036723.1.28500 WP_000036723.1.28509 WP_000036723.1.28523 WP_000036723.1.28536 WP_000036723.1.28540 WP_000036723.1.28544 WP_000036723.1.28551 WP_000036723.1.28554 WP_000036723.1.28568 WP_000036723.1.28639 WP_000036723.1.2866 WP_000036723.1.28662 WP_000036723.1.28683 WP_000036723.1.28697 WP_000036723.1.28711 WP_000036723.1.28723 WP_000036723.1.28732 WP_000036723.1.28734 WP_000036723.1.28736 WP_000036723.1.28742 WP_000036723.1.28760 WP_000036723.1.28762 WP_000036723.1.28809 WP_000036723.1.2881 WP_000036723.1.28829 WP_000036723.1.28842 WP_000036723.1.28863 WP_000036723.1.28879 WP_000036723.1.28919 WP_000036723.1.28924 WP_000036723.1.28950 WP_000036723.1.28953 WP_000036723.1.28982 WP_000036723.1.28994 WP_000036723.1.29001 WP_000036723.1.29013 WP_000036723.1.29016 WP_000036723.1.29026 WP_000036723.1.29049 WP_000036723.1.29061 WP_000036723.1.29082 WP_000036723.1.291 WP_000036723.1.29100 WP_000036723.1.29118 WP_000036723.1.29125 WP_000036723.1.29126 WP_000036723.1.29128 WP_000036723.1.29150 WP_000036723.1.29164 WP_000036723.1.29176 WP_000036723.1.29194 WP_000036723.1.29202 WP_000036723.1.29206 WP_000036723.1.29221 WP_000036723.1.29230 WP_000036723.1.29239 WP_000036723.1.29252 WP_000036723.1.29258 WP_000036723.1.2926 WP_000036723.1.2931 WP_000036723.1.29341 WP_000036723.1.29377 WP_000036723.1.29394 WP_000036723.1.29404 WP_000036723.1.2942 WP_000036723.1.29429 WP_000036723.1.29443 WP_000036723.1.2945 WP_000036723.1.29486 WP_000036723.1.29495 WP_000036723.1.29497 WP_000036723.1.29503 WP_000036723.1.29504 WP_000036723.1.29513 WP_000036723.1.2952 WP_000036723.1.29523 WP_000036723.1.2954 WP_000036723.1.29564 WP_000036723.1.29590 WP_000036723.1.29597 WP_000036723.1.29603 WP_000036723.1.29618 WP_000036723.1.2963 WP_000036723.1.29647 WP_000036723.1.29662 WP_000036723.1.29669 WP_000036723.1.29683 WP_000036723.1.29689 WP_000036723.1.29715 WP_000036723.1.29724 WP_000036723.1.29746 WP_000036723.1.29752 WP_000036723.1.2978 WP_000036723.1.29798 WP_000036723.1.29812 WP_000036723.1.29815 WP_000036723.1.29818 WP_000036723.1.29819 WP_000036723.1.29820 WP_000036723.1.29821 WP_000036723.1.29840 WP_000036723.1.29855 WP_000036723.1.29874 WP_000036723.1.29876 WP_000036723.1.29884 WP_000036723.1.29893 WP_000036723.1.2995 WP_000036723.1.29967 WP_000036723.1.29976 WP_000036723.1.29979 WP_000036723.1.29988 WP_000036723.1.29992 WP_000036723.1.30 WP_000036723.1.30004 WP_000036723.1.30019 WP_000036723.1.30035 WP_000036723.1.30052 WP_000036723.1.30063 WP_000036723.1.30064 WP_000036723.1.30098 WP_000036723.1.30105 WP_000036723.1.30123 WP_000036723.1.30164 WP_000036723.1.3018 WP_000036723.1.30222 WP_000036723.1.30231 WP_000036723.1.30232 WP_000036723.1.30239 WP_000036723.1.30247 WP_000036723.1.30253 WP_000036723.1.30269 WP_000036723.1.30298 WP_000036723.1.30391 WP_000036723.1.30397 WP_000036723.1.30399 WP_000036723.1.30400 WP_000036723.1.30428 WP_000036723.1.30447 WP_000036723.1.3045 WP_000036723.1.30452 WP_000036723.1.30472 WP_000036723.1.30476 WP_000036723.1.30479 WP_000036723.1.30497 WP_000036723.1.30524 WP_000036723.1.30536 WP_000036723.1.30546 WP_000036723.1.3055 WP_000036723.1.30550 WP_000036723.1.30554 WP_000036723.1.30570 WP_000036723.1.30580 WP_000036723.1.306 WP_000036723.1.3063 WP_000036723.1.30630 WP_000036723.1.30637 WP_000036723.1.30639 WP_000036723.1.30640 WP_000036723.1.30658 WP_000036723.1.30665 WP_000036723.1.30691 WP_000036723.1.30733 WP_000036723.1.30742 WP_000036723.1.30749 WP_000036723.1.30762 WP_000036723.1.30783 WP_000036723.1.30808 WP_000036723.1.3083 WP_000036723.1.30843 WP_000036723.1.30853 WP_000036723.1.30866 WP_000036723.1.30867 WP_000036723.1.30879 WP_000036723.1.30887 WP_000036723.1.30896 WP_000036723.1.309 WP_000036723.1.30905 WP_000036723.1.30906 WP_000036723.1.30918 WP_000036723.1.30987 WP_000036723.1.30993 WP_000036723.1.30999 WP_000036723.1.31000 WP_000036723.1.31009 WP_000036723.1.31017 WP_000036723.1.31029 WP_000036723.1.31055 WP_000036723.1.31083 WP_000036723.1.31089 WP_000036723.1.31119 WP_000036723.1.31129 WP_000036723.1.31142 WP_000036723.1.31149 WP_000036723.1.31154 WP_000036723.1.31188 WP_000036723.1.312 WP_000036723.1.31211 WP_000036723.1.31252 WP_000036723.1.31295 WP_000036723.1.31319 WP_000036723.1.31340 WP_000036723.1.31347 WP_000036723.1.31357 WP_000036723.1.31372 WP_000036723.1.31379 WP_000036723.1.3140 WP_000036723.1.31401 WP_000036723.1.31407 WP_000036723.1.31419 WP_000036723.1.31421 WP_000036723.1.31422 WP_000036723.1.31431 WP_000036723.1.31433 WP_000036723.1.3147 WP_000036723.1.31506 WP_000036723.1.31509 WP_000036723.1.31511 WP_000036723.1.31518 WP_000036723.1.31521 WP_000036723.1.31542 WP_000036723.1.31557 WP_000036723.1.31559 WP_000036723.1.31575 WP_000036723.1.31596 WP_000036723.1.31614 WP_000036723.1.31618 WP_000036723.1.31639 WP_000036723.1.31657 WP_000036723.1.31679 WP_000036723.1.31681 WP_000036723.1.3169 WP_000036723.1.31709 WP_000036723.1.31715 WP_000036723.1.31740 WP_000036723.1.3176 WP_000036723.1.31803 WP_000036723.1.31809 WP_000036723.1.3181 WP_000036723.1.31823 WP_000036723.1.31825 WP_000036723.1.31833 WP_000036723.1.31835 WP_000036723.1.31839 WP_000036723.1.31860 WP_000036723.1.31863 WP_000036723.1.31866 WP_000036723.1.31878 WP_000036723.1.31898 WP_000036723.1.31924 WP_000036723.1.31928 WP_000036723.1.3193 WP_000036723.1.31956 WP_000036723.1.31978 WP_000036723.1.3201 WP_000036723.1.32020 WP_000036723.1.32021 WP_000036723.1.32024 WP_000036723.1.3203 WP_000036723.1.32030 WP_000036723.1.32037 WP_000036723.1.32063 WP_000036723.1.32089 WP_000036723.1.32091 WP_000036723.1.32093 WP_000036723.1.32094 WP_000036723.1.3212 WP_000036723.1.32121 WP_000036723.1.32127 WP_000036723.1.32138 WP_000036723.1.32142 WP_000036723.1.32143 WP_000036723.1.3215 WP_000036723.1.32173 WP_000036723.1.32184 WP_000036723.1.322 WP_000036723.1.32222 WP_000036723.1.32225 WP_000036723.1.32232 WP_000036723.1.32234 WP_000036723.1.32236 WP_000036723.1.32243 WP_000036723.1.32279 WP_000036723.1.32287 WP_000036723.1.3233 WP_000036723.1.32394 WP_000036723.1.32406 WP_000036723.1.32432 WP_000036723.1.32443 WP_000036723.1.3247 WP_000036723.1.32475 WP_000036723.1.32478 WP_000036723.1.32479 WP_000036723.1.3248 WP_000036723.1.32480 WP_000036723.1.32494 WP_000036723.1.32509 WP_000036723.1.32518 WP_000036723.1.32536 WP_000036723.1.32558 WP_000036723.1.32561 WP_000036723.1.32574 WP_000036723.1.32580 WP_000036723.1.32587 WP_000036723.1.3259 WP_000036723.1.32590 WP_000036723.1.32591 WP_000036723.1.32601 WP_000036723.1.32635 WP_000036723.1.32650 WP_000036723.1.32655 WP_000036723.1.32661 WP_000036723.1.32676 WP_000036723.1.32680 WP_000036723.1.3269 WP_000036723.1.32709 WP_000036723.1.32718 WP_000036723.1.32720 WP_000036723.1.32722 WP_000036723.1.32724 WP_000036723.1.32748 WP_000036723.1.32772 WP_000036723.1.32811 WP_000036723.1.32815 WP_000036723.1.32831 WP_000036723.1.32835 WP_000036723.1.32875 WP_000036723.1.32888 WP_000036723.1.32903 WP_000036723.1.32910 WP_000036723.1.32931 WP_000036723.1.32938 WP_000036723.1.32946 WP_000036723.1.3295 WP_000036723.1.32959 WP_000036723.1.32972 WP_000036723.1.32984 WP_000036723.1.32992 WP_000036723.1.32995 WP_000036723.1.33004 WP_000036723.1.33014 WP_000036723.1.33018 WP_000036723.1.33022 WP_000036723.1.33026 WP_000036723.1.33046 WP_000036723.1.33049 WP_000036723.1.33053 WP_000036723.1.33055 WP_000036723.1.33094 WP_000036723.1.33101 WP_000036723.1.33119 WP_000036723.1.33125 WP_000036723.1.33146 WP_000036723.1.33178 WP_000036723.1.33179 WP_000036723.1.33190 WP_000036723.1.33217 WP_000036723.1.33222 WP_000036723.1.3323 WP_000036723.1.33237 WP_000036723.1.33244 WP_000036723.1.33268 WP_000036723.1.33303 WP_000036723.1.33325 WP_000036723.1.33341 WP_000036723.1.33352 WP_000036723.1.33369 WP_000036723.1.33385 WP_000036723.1.334 WP_000036723.1.33408 WP_000036723.1.33410 WP_000036723.1.33422 WP_000036723.1.33424 WP_000036723.1.33428 WP_000036723.1.3344 WP_000036723.1.33475 WP_000036723.1.33476 WP_000036723.1.33502 WP_000036723.1.33512 WP_000036723.1.33525 WP_000036723.1.33526 WP_000036723.1.3354 WP_000036723.1.33563 WP_000036723.1.33565 WP_000036723.1.33584 WP_000036723.1.33595 WP_000036723.1.33631 WP_000036723.1.33638 WP_000036723.1.33648 WP_000036723.1.33667 WP_000036723.1.33680 WP_000036723.1.33736 WP_000036723.1.33745 WP_000036723.1.33746 WP_000036723.1.33751 WP_000036723.1.33799 WP_000036723.1.33823 WP_000036723.1.33853 WP_000036723.1.33854 WP_000036723.1.33879 WP_000036723.1.33888 WP_000036723.1.33896 WP_000036723.1.33905 WP_000036723.1.33914 WP_000036723.1.33948 WP_000036723.1.33952 WP_000036723.1.33973 WP_000036723.1.33974 WP_000036723.1.33979 WP_000036723.1.3398 WP_000036723.1.33981 WP_000036723.1.3401 WP_000036723.1.34032 WP_000036723.1.34094 WP_000036723.1.3411 WP_000036723.1.34117 WP_000036723.1.34121 WP_000036723.1.34122 WP_000036723.1.34124 WP_000036723.1.34130 WP_000036723.1.34144 WP_000036723.1.342 WP_000036723.1.34204 WP_000036723.1.34208 WP_000036723.1.34224 WP_000036723.1.34269 WP_000036723.1.34270 WP_000036723.1.34273 WP_000036723.1.34277 WP_000036723.1.34294 WP_000036723.1.34303 WP_000036723.1.3432 WP_000036723.1.34332 WP_000036723.1.34341 WP_000036723.1.34348 WP_000036723.1.34362 WP_000036723.1.34363 WP_000036723.1.34383 WP_000036723.1.3439 WP_000036723.1.34397 WP_000036723.1.34400 WP_000036723.1.34422 WP_000036723.1.3444 WP_000036723.1.34440 WP_000036723.1.34441 WP_000036723.1.34444 WP_000036723.1.34456 WP_000036723.1.34464 WP_000036723.1.34470 WP_000036723.1.34500 WP_000036723.1.34525 WP_000036723.1.34528 WP_000036723.1.34532 WP_000036723.1.34538 WP_000036723.1.34558 WP_000036723.1.3460 WP_000036723.1.34605 WP_000036723.1.34617 WP_000036723.1.34675 WP_000036723.1.34680 WP_000036723.1.34682 WP_000036723.1.34683 WP_000036723.1.34686 WP_000036723.1.347 WP_000036723.1.3472 WP_000036723.1.34727 WP_000036723.1.34763 WP_000036723.1.34781 WP_000036723.1.34782 WP_000036723.1.34794 WP_000036723.1.34827 WP_000036723.1.34835 WP_000036723.1.34838 WP_000036723.1.34855 WP_000036723.1.34875 WP_000036723.1.34887 WP_000036723.1.34913 WP_000036723.1.34931 WP_000036723.1.34948 WP_000036723.1.34966 WP_000036723.1.34982 WP_000036723.1.34990 WP_000036723.1.34993 WP_000036723.1.35003 WP_000036723.1.35006 WP_000036723.1.35007 WP_000036723.1.35012 WP_000036723.1.35039 WP_000036723.1.35107 WP_000036723.1.35114 WP_000036723.1.35127 WP_000036723.1.35132 WP_000036723.1.3515 WP_000036723.1.35168 WP_000036723.1.35180 WP_000036723.1.35186 WP_000036723.1.35195 WP_000036723.1.35198 WP_000036723.1.35202 WP_000036723.1.35204 WP_000036723.1.35208 WP_000036723.1.35211 WP_000036723.1.35220 WP_000036723.1.35253 WP_000036723.1.35258 WP_000036723.1.35316 WP_000036723.1.35328 WP_000036723.1.35349 WP_000036723.1.35360 WP_000036723.1.35365 WP_000036723.1.35368 WP_000036723.1.35376 WP_000036723.1.3539 WP_000036723.1.35393 WP_000036723.1.35394 WP_000036723.1.35398 WP_000036723.1.35448 WP_000036723.1.35464 WP_000036723.1.35465 WP_000036723.1.35466 WP_000036723.1.35468 WP_000036723.1.35483 WP_000036723.1.3550 WP_000036723.1.35552 WP_000036723.1.35578 WP_000036723.1.35581 WP_000036723.1.3560 WP_000036723.1.35604 WP_000036723.1.35627 WP_000036723.1.35649 WP_000036723.1.35651 WP_000036723.1.35653 WP_000036723.1.35698 WP_000036723.1.35704 WP_000036723.1.35724 WP_000036723.1.35740 WP_000036723.1.35741 WP_000036723.1.35744 WP_000036723.1.35789 WP_000036723.1.35889 WP_000036723.1.35904 WP_000036723.1.35922 WP_000036723.1.35927 WP_000036723.1.35934 WP_000036723.1.35942 WP_000036723.1.35959 WP_000036723.1.35963 WP_000036723.1.3598 WP_000036723.1.35985 WP_000036723.1.35987 WP_000036723.1.35990 WP_000036723.1.3600 WP_000036723.1.36010 WP_000036723.1.36040 WP_000036723.1.36042 WP_000036723.1.36070 WP_000036723.1.36071 WP_000036723.1.36085 WP_000036723.1.36094 WP_000036723.1.36105 WP_000036723.1.36129 WP_000036723.1.36132 WP_000036723.1.36158 WP_000036723.1.36164 WP_000036723.1.36166 WP_000036723.1.36177 WP_000036723.1.36182 WP_000036723.1.3620 WP_000036723.1.36207 WP_000036723.1.36212 WP_000036723.1.3624 WP_000036723.1.36332 WP_000036723.1.36334 WP_000036723.1.36352 WP_000036723.1.36386 WP_000036723.1.36393 WP_000036723.1.36405 WP_000036723.1.36412 WP_000036723.1.36414 WP_000036723.1.36426 WP_000036723.1.3643 WP_000036723.1.36453 WP_000036723.1.36459 WP_000036723.1.36496 WP_000036723.1.365 WP_000036723.1.36500 WP_000036723.1.36507 WP_000036723.1.36523 WP_000036723.1.36531 WP_000036723.1.36545 WP_000036723.1.36610 WP_000036723.1.36626 WP_000036723.1.36627 WP_000036723.1.36628 WP_000036723.1.36667 WP_000036723.1.3668 WP_000036723.1.36699 WP_000036723.1.36707 WP_000036723.1.3671 WP_000036723.1.36724 WP_000036723.1.36739 WP_000036723.1.36746 WP_000036723.1.36761 WP_000036723.1.36767 WP_000036723.1.36786 WP_000036723.1.36799 WP_000036723.1.36806 WP_000036723.1.36812 WP_000036723.1.36817 WP_000036723.1.36826 WP_000036723.1.36833 WP_000036723.1.36856 WP_000036723.1.36886 WP_000036723.1.36894 WP_000036723.1.3697 WP_000036723.1.36975 WP_000036723.1.37006 WP_000036723.1.37020 WP_000036723.1.37032 WP_000036723.1.37046 WP_000036723.1.37049 WP_000036723.1.37099 WP_000036723.1.37102 WP_000036723.1.37103 WP_000036723.1.37122 WP_000036723.1.37146 WP_000036723.1.37153 WP_000036723.1.37155 WP_000036723.1.37226 WP_000036723.1.3723 WP_000036723.1.37233 WP_000036723.1.37252 WP_000036723.1.37261 WP_000036723.1.37266 WP_000036723.1.37290 WP_000036723.1.37306 WP_000036723.1.37312 WP_000036723.1.37329 WP_000036723.1.37334 WP_000036723.1.37337 WP_000036723.1.37342 WP_000036723.1.37352 WP_000036723.1.37360 WP_000036723.1.37371 WP_000036723.1.37372 WP_000036723.1.37388 WP_000036723.1.37419 WP_000036723.1.37423 WP_000036723.1.37433 WP_000036723.1.37445 WP_000036723.1.37472 WP_000036723.1.37476 WP_000036723.1.37477 WP_000036723.1.37485 WP_000036723.1.37510 WP_000036723.1.37516 WP_000036723.1.37538 WP_000036723.1.37544 WP_000036723.1.37548 WP_000036723.1.37549 WP_000036723.1.37550 WP_000036723.1.37554 WP_000036723.1.37576 WP_000036723.1.37588 WP_000036723.1.37592 WP_000036723.1.37608 WP_000036723.1.3762 WP_000036723.1.37634 WP_000036723.1.37637 WP_000036723.1.37664 WP_000036723.1.377 WP_000036723.1.3772 WP_000036723.1.37730 WP_000036723.1.37731 WP_000036723.1.37736 WP_000036723.1.37745 WP_000036723.1.37750 WP_000036723.1.37758 WP_000036723.1.37762 WP_000036723.1.37766 WP_000036723.1.37769 WP_000036723.1.37773 WP_000036723.1.37817 WP_000036723.1.37830 WP_000036723.1.37852 WP_000036723.1.37853 WP_000036723.1.3788 WP_000036723.1.37880 WP_000036723.1.37887 WP_000036723.1.37897 WP_000036723.1.37917 WP_000036723.1.37923 WP_000036723.1.37926 WP_000036723.1.3795 WP_000036723.1.3796 WP_000036723.1.37962 WP_000036723.1.37964 WP_000036723.1.37967 WP_000036723.1.37984 WP_000036723.1.37995 WP_000036723.1.37998 WP_000036723.1.38000 WP_000036723.1.38033 WP_000036723.1.38043 WP_000036723.1.38050 WP_000036723.1.38063 WP_000036723.1.38080 WP_000036723.1.38081 WP_000036723.1.38085 WP_000036723.1.38103 WP_000036723.1.38105 WP_000036723.1.38107 WP_000036723.1.3811 WP_000036723.1.38119 WP_000036723.1.38120 WP_000036723.1.3815 WP_000036723.1.38155 WP_000036723.1.38162 WP_000036723.1.38182 WP_000036723.1.38185 WP_000036723.1.38194 WP_000036723.1.38202 WP_000036723.1.38211 WP_000036723.1.3822 WP_000036723.1.38234 WP_000036723.1.38257 WP_000036723.1.38293 WP_000036723.1.38300 WP_000036723.1.38306 WP_000036723.1.38314 WP_000036723.1.38323 WP_000036723.1.38357 WP_000036723.1.38363 WP_000036723.1.38369 WP_000036723.1.38371 WP_000036723.1.38392 WP_000036723.1.38412 WP_000036723.1.38485 WP_000036723.1.38533 WP_000036723.1.38544 WP_000036723.1.38561 WP_000036723.1.38567 WP_000036723.1.38584 WP_000036723.1.38626 WP_000036723.1.38629 WP_000036723.1.38636 WP_000036723.1.38694 WP_000036723.1.38722 WP_000036723.1.3873 WP_000036723.1.38751 WP_000036723.1.38777 WP_000036723.1.38782 WP_000036723.1.38811 WP_000036723.1.38827 WP_000036723.1.38835 WP_000036723.1.38843 WP_000036723.1.38896 WP_000036723.1.389 WP_000036723.1.38911 WP_000036723.1.38920 WP_000036723.1.38950 WP_000036723.1.38956 WP_000036723.1.38958 WP_000036723.1.39005 WP_000036723.1.39037 WP_000036723.1.3904 WP_000036723.1.39042 WP_000036723.1.39063 WP_000036723.1.39103 WP_000036723.1.3912 WP_000036723.1.39123 WP_000036723.1.39148 WP_000036723.1.39150 WP_000036723.1.39155 WP_000036723.1.39164 WP_000036723.1.39167 WP_000036723.1.39171 WP_000036723.1.39180 WP_000036723.1.39184 WP_000036723.1.39196 WP_000036723.1.39209 WP_000036723.1.3921 WP_000036723.1.3922 WP_000036723.1.39232 WP_000036723.1.39249 WP_000036723.1.39254 WP_000036723.1.39268 WP_000036723.1.39286 WP_000036723.1.39289 WP_000036723.1.39302 WP_000036723.1.39305 WP_000036723.1.39310 WP_000036723.1.39313 WP_000036723.1.39325 WP_000036723.1.39327 WP_000036723.1.39335 WP_000036723.1.39342 WP_000036723.1.39356 WP_000036723.1.39358 WP_000036723.1.39365 WP_000036723.1.39367 WP_000036723.1.39377 WP_000036723.1.39401 WP_000036723.1.39402 WP_000036723.1.39415 WP_000036723.1.39423 WP_000036723.1.39430 WP_000036723.1.39481 WP_000036723.1.39492 WP_000036723.1.39509 WP_000036723.1.39531 WP_000036723.1.3954 WP_000036723.1.39541 WP_000036723.1.39564 WP_000036723.1.39575 WP_000036723.1.39601 WP_000036723.1.39606 WP_000036723.1.39607 WP_000036723.1.39610 WP_000036723.1.39626 WP_000036723.1.39636 WP_000036723.1.39646 WP_000036723.1.39651 WP_000036723.1.39690 WP_000036723.1.3970 WP_000036723.1.39708 WP_000036723.1.39709 WP_000036723.1.39713 WP_000036723.1.39715 WP_000036723.1.39717 WP_000036723.1.39726 WP_000036723.1.39733 WP_000036723.1.39734 WP_000036723.1.39758 WP_000036723.1.39780 WP_000036723.1.39796 WP_000036723.1.3980 WP_000036723.1.39809 WP_000036723.1.39818 WP_000036723.1.39820 WP_000036723.1.39822 WP_000036723.1.39829 WP_000036723.1.39867 WP_000036723.1.39870 WP_000036723.1.39892 WP_000036723.1.39938 WP_000036723.1.39961 WP_000036723.1.39966 WP_000036723.1.39970 WP_000036723.1.39973 WP_000036723.1.39992 WP_000036723.1.39998 WP_000036723.1.40 WP_000036723.1.40013 WP_000036723.1.40016 WP_000036723.1.40019 WP_000036723.1.4005 WP_000036723.1.40083 WP_000036723.1.40088 WP_000036723.1.40107 WP_000036723.1.40113 WP_000036723.1.40140 WP_000036723.1.40147 WP_000036723.1.40153 WP_000036723.1.40190 WP_000036723.1.40192 WP_000036723.1.4020 WP_000036723.1.40206 WP_000036723.1.40211 WP_000036723.1.40212 WP_000036723.1.40218 WP_000036723.1.40234 WP_000036723.1.40238 WP_000036723.1.40249 WP_000036723.1.40298 WP_000036723.1.4030 WP_000036723.1.40300 WP_000036723.1.40315 WP_000036723.1.40317 WP_000036723.1.40319 WP_000036723.1.40335 WP_000036723.1.40345 WP_000036723.1.40349 WP_000036723.1.40360 WP_000036723.1.40382 WP_000036723.1.40389 WP_000036723.1.40391 WP_000036723.1.40403 WP_000036723.1.40445 WP_000036723.1.40486 WP_000036723.1.4049 WP_000036723.1.40499 WP_000036723.1.40502 WP_000036723.1.40509 WP_000036723.1.40524 WP_000036723.1.40539 WP_000036723.1.40548 WP_000036723.1.40549 WP_000036723.1.40560 WP_000036723.1.40563 WP_000036723.1.40596 WP_000036723.1.40599 WP_000036723.1.406 WP_000036723.1.40607 WP_000036723.1.40617 WP_000036723.1.40629 WP_000036723.1.40636 WP_000036723.1.40657 WP_000036723.1.40660 WP_000036723.1.40666 WP_000036723.1.40686 WP_000036723.1.40712 WP_000036723.1.40715 WP_000036723.1.40742 WP_000036723.1.40758 WP_000036723.1.40781 WP_000036723.1.40793 WP_000036723.1.40813 WP_000036723.1.40815 WP_000036723.1.4082 WP_000036723.1.40833 WP_000036723.1.40842 WP_000036723.1.40843 WP_000036723.1.40865 WP_000036723.1.40882 WP_000036723.1.40893 WP_000036723.1.40898 WP_000036723.1.40900 WP_000036723.1.40912 WP_000036723.1.40937 WP_000036723.1.40952 WP_000036723.1.40965 WP_000036723.1.4103 WP_000036723.1.41037 WP_000036723.1.41041 WP_000036723.1.41045 WP_000036723.1.41060 WP_000036723.1.41063 WP_000036723.1.41078 WP_000036723.1.41113 WP_000036723.1.41125 WP_000036723.1.41147 WP_000036723.1.41206 WP_000036723.1.4122 WP_000036723.1.41239 WP_000036723.1.4126 WP_000036723.1.41263 WP_000036723.1.41271 WP_000036723.1.41287 WP_000036723.1.41294 WP_000036723.1.41315 WP_000036723.1.41330 WP_000036723.1.41332 WP_000036723.1.41339 WP_000036723.1.41346 WP_000036723.1.41363 WP_000036723.1.41368 WP_000036723.1.41371 WP_000036723.1.41372 WP_000036723.1.41391 WP_000036723.1.41392 WP_000036723.1.41394 WP_000036723.1.41401 WP_000036723.1.41402 WP_000036723.1.41407 WP_000036723.1.41417 WP_000036723.1.4142 WP_000036723.1.41436 WP_000036723.1.41449 WP_000036723.1.41453 WP_000036723.1.41455 WP_000036723.1.41466 WP_000036723.1.41478 WP_000036723.1.41481 WP_000036723.1.41482 WP_000036723.1.41483 WP_000036723.1.41484 WP_000036723.1.41488 WP_000036723.1.41530 WP_000036723.1.41536 WP_000036723.1.41539 WP_000036723.1.41545 WP_000036723.1.41556 WP_000036723.1.41566 WP_000036723.1.4158 WP_000036723.1.41613 WP_000036723.1.41621 WP_000036723.1.41651 WP_000036723.1.41654 WP_000036723.1.41712 WP_000036723.1.4172 WP_000036723.1.41734 WP_000036723.1.41740 WP_000036723.1.41741 WP_000036723.1.41752 WP_000036723.1.41780 WP_000036723.1.41782 WP_000036723.1.41783 WP_000036723.1.41784 WP_000036723.1.41809 WP_000036723.1.41812 WP_000036723.1.41813 WP_000036723.1.41822 WP_000036723.1.41826 WP_000036723.1.41837 WP_000036723.1.41847 WP_000036723.1.41849 WP_000036723.1.41884 WP_000036723.1.41885 WP_000036723.1.4189 WP_000036723.1.41900 WP_000036723.1.41923 WP_000036723.1.4193 WP_000036723.1.41956 WP_000036723.1.41960 WP_000036723.1.41988 WP_000036723.1.41990 WP_000036723.1.41991 WP_000036723.1.42022 WP_000036723.1.42027 WP_000036723.1.42033 WP_000036723.1.42036 WP_000036723.1.42038 WP_000036723.1.42060 WP_000036723.1.42073 WP_000036723.1.42113 WP_000036723.1.4213 WP_000036723.1.42138 WP_000036723.1.4214 WP_000036723.1.42151 WP_000036723.1.42159 WP_000036723.1.42179 WP_000036723.1.42191 WP_000036723.1.42203 WP_000036723.1.42209 WP_000036723.1.42214 WP_000036723.1.42221 WP_000036723.1.42226 WP_000036723.1.42228 WP_000036723.1.42233 WP_000036723.1.4224 WP_000036723.1.42252 WP_000036723.1.42258 WP_000036723.1.42318 WP_000036723.1.42350 WP_000036723.1.42367 WP_000036723.1.42376 WP_000036723.1.42387 WP_000036723.1.42413 WP_000036723.1.42415 WP_000036723.1.4242 WP_000036723.1.42432 WP_000036723.1.42442 WP_000036723.1.42443 WP_000036723.1.42447 WP_000036723.1.42448 WP_000036723.1.42480 WP_000036723.1.4250 WP_000036723.1.42513 WP_000036723.1.42516 WP_000036723.1.42522 WP_000036723.1.42547 WP_000036723.1.42586 WP_000036723.1.42594 WP_000036723.1.42597 WP_000036723.1.42600 WP_000036723.1.42601 WP_000036723.1.4261 WP_000036723.1.42632 WP_000036723.1.42638 WP_000036723.1.42661 WP_000036723.1.42669 WP_000036723.1.42670 WP_000036723.1.42677 WP_000036723.1.42709 WP_000036723.1.42728 WP_000036723.1.42748 WP_000036723.1.42749 WP_000036723.1.42756 WP_000036723.1.42770 WP_000036723.1.42771 WP_000036723.1.42804 WP_000036723.1.42808 WP_000036723.1.42813 WP_000036723.1.4282 WP_000036723.1.42832 WP_000036723.1.42863 WP_000036723.1.42879 WP_000036723.1.42880 WP_000036723.1.42891 WP_000036723.1.4290 WP_000036723.1.42903 WP_000036723.1.42918 WP_000036723.1.42936 WP_000036723.1.42937 WP_000036723.1.42950 WP_000036723.1.42962 WP_000036723.1.42970 WP_000036723.1.42975 WP_000036723.1.42987 WP_000036723.1.42989 WP_000036723.1.42991 WP_000036723.1.43013 WP_000036723.1.43035 WP_000036723.1.4306 WP_000036723.1.43079 WP_000036723.1.43121 WP_000036723.1.43123 WP_000036723.1.4313 WP_000036723.1.43132 WP_000036723.1.43133 WP_000036723.1.43137 WP_000036723.1.43140 WP_000036723.1.43166 WP_000036723.1.43170 WP_000036723.1.43174 WP_000036723.1.43177 WP_000036723.1.43196 WP_000036723.1.43213 WP_000036723.1.43239 WP_000036723.1.43270 WP_000036723.1.43278 WP_000036723.1.43316 WP_000036723.1.4334 WP_000036723.1.43363 WP_000036723.1.43384 WP_000036723.1.43389 WP_000036723.1.4342 WP_000036723.1.43422 WP_000036723.1.43427 WP_000036723.1.4343 WP_000036723.1.43444 WP_000036723.1.43448 WP_000036723.1.43455 WP_000036723.1.43469 WP_000036723.1.43473 WP_000036723.1.43474 WP_000036723.1.43489 WP_000036723.1.43501 WP_000036723.1.43536 WP_000036723.1.4356 WP_000036723.1.43561 WP_000036723.1.43598 WP_000036723.1.436 WP_000036723.1.43604 WP_000036723.1.43622 WP_000036723.1.43642 WP_000036723.1.43720 WP_000036723.1.43733 WP_000036723.1.43738 WP_000036723.1.43750 WP_000036723.1.43754 WP_000036723.1.43769 WP_000036723.1.43798 WP_000036723.1.43803 WP_000036723.1.43804 WP_000036723.1.43816 WP_000036723.1.43837 WP_000036723.1.43858 WP_000036723.1.43868 WP_000036723.1.43898 WP_000036723.1.43911 WP_000036723.1.43925 WP_000036723.1.43939 WP_000036723.1.43942 WP_000036723.1.43953 WP_000036723.1.43966 WP_000036723.1.43989 WP_000036723.1.440 WP_000036723.1.44018 WP_000036723.1.44020 WP_000036723.1.44029 WP_000036723.1.44040 WP_000036723.1.44051 WP_000036723.1.44075 WP_000036723.1.44077 WP_000036723.1.44088 WP_000036723.1.44096 WP_000036723.1.44100 WP_000036723.1.4411 WP_000036723.1.44115 WP_000036723.1.44125 WP_000036723.1.44130 WP_000036723.1.44133 WP_000036723.1.4415 WP_000036723.1.44162 WP_000036723.1.44165 WP_000036723.1.44166 WP_000036723.1.44201 WP_000036723.1.44203 WP_000036723.1.44211 WP_000036723.1.44222 WP_000036723.1.44238 WP_000036723.1.44251 WP_000036723.1.44263 WP_000036723.1.44264 WP_000036723.1.44273 WP_000036723.1.44285 WP_000036723.1.44287 WP_000036723.1.44292 WP_000036723.1.44324 WP_000036723.1.44327 WP_000036723.1.44354 WP_000036723.1.44365 WP_000036723.1.44389 WP_000036723.1.44394 WP_000036723.1.44422 WP_000036723.1.44445 WP_000036723.1.44447 WP_000036723.1.4445 WP_000036723.1.44452 WP_000036723.1.44458 WP_000036723.1.44461 WP_000036723.1.44488 WP_000036723.1.4449 WP_000036723.1.44524 WP_000036723.1.4454 WP_000036723.1.44558 WP_000036723.1.44561 WP_000036723.1.44570 WP_000036723.1.44587 WP_000036723.1.4459 WP_000036723.1.44608 WP_000036723.1.44610 WP_000036723.1.44622 WP_000036723.1.44627 WP_000036723.1.4463 WP_000036723.1.44642 WP_000036723.1.44649 WP_000036723.1.44661 WP_000036723.1.44668 WP_000036723.1.44671 WP_000036723.1.4471 WP_000036723.1.44717 WP_000036723.1.44724 WP_000036723.1.44733 WP_000036723.1.44756 WP_000036723.1.44784 WP_000036723.1.44821 WP_000036723.1.44836 WP_000036723.1.44840 WP_000036723.1.44841 WP_000036723.1.44843 WP_000036723.1.44849 WP_000036723.1.44854 WP_000036723.1.44855 WP_000036723.1.44857 WP_000036723.1.44906 WP_000036723.1.44923 WP_000036723.1.44954 WP_000036723.1.44960 WP_000036723.1.44970 WP_000036723.1.44975 WP_000036723.1.44977 WP_000036723.1.44980 WP_000036723.1.45020 WP_000036723.1.45025 WP_000036723.1.45028 WP_000036723.1.45043 WP_000036723.1.45053 WP_000036723.1.45076 WP_000036723.1.45104 WP_000036723.1.45116 WP_000036723.1.4515 WP_000036723.1.45153 WP_000036723.1.4516 WP_000036723.1.45190 WP_000036723.1.45195 WP_000036723.1.45208 WP_000036723.1.4524 WP_000036723.1.45246 WP_000036723.1.45293 WP_000036723.1.4530 WP_000036723.1.45301 WP_000036723.1.45313 WP_000036723.1.45329 WP_000036723.1.4535 WP_000036723.1.45359 WP_000036723.1.4538 WP_000036723.1.45392 WP_000036723.1.45404 WP_000036723.1.45405 WP_000036723.1.4541 WP_000036723.1.45440 WP_000036723.1.45444 WP_000036723.1.45486 WP_000036723.1.4549 WP_000036723.1.45525 WP_000036723.1.45536 WP_000036723.1.45538 WP_000036723.1.45565 WP_000036723.1.45575 WP_000036723.1.45581 WP_000036723.1.45595 WP_000036723.1.45600 WP_000036723.1.45627 WP_000036723.1.4563 WP_000036723.1.45664 WP_000036723.1.45674 WP_000036723.1.45676 WP_000036723.1.4570 WP_000036723.1.45707 WP_000036723.1.45718 WP_000036723.1.4574 WP_000036723.1.45740 WP_000036723.1.45741 WP_000036723.1.45752 WP_000036723.1.4576 WP_000036723.1.45789 WP_000036723.1.45793 WP_000036723.1.45799 WP_000036723.1.45801 WP_000036723.1.45806 WP_000036723.1.4583 WP_000036723.1.45840 WP_000036723.1.45841 WP_000036723.1.45846 WP_000036723.1.45865 WP_000036723.1.45868 WP_000036723.1.45891 WP_000036723.1.45901 WP_000036723.1.45921 WP_000036723.1.4593 WP_000036723.1.45930 WP_000036723.1.45931 WP_000036723.1.45933 WP_000036723.1.45941 WP_000036723.1.45945 WP_000036723.1.45949 WP_000036723.1.45960 WP_000036723.1.45968 WP_000036723.1.45990 WP_000036723.1.4600 WP_000036723.1.46016 WP_000036723.1.46026 WP_000036723.1.46027 WP_000036723.1.46039 WP_000036723.1.46048 WP_000036723.1.46049 WP_000036723.1.46070 WP_000036723.1.46081 WP_000036723.1.46097 WP_000036723.1.4610 WP_000036723.1.46105 WP_000036723.1.46115 WP_000036723.1.46122 WP_000036723.1.4613 WP_000036723.1.46164 WP_000036723.1.46186 WP_000036723.1.4619 WP_000036723.1.46197 WP_000036723.1.46213 WP_000036723.1.46217 WP_000036723.1.46239 WP_000036723.1.46257 WP_000036723.1.46263 WP_000036723.1.46282 WP_000036723.1.46283 WP_000036723.1.46291 WP_000036723.1.46301 WP_000036723.1.46325 WP_000036723.1.46329 WP_000036723.1.46369 WP_000036723.1.46378 WP_000036723.1.46379 WP_000036723.1.46414 WP_000036723.1.46429 WP_000036723.1.46433 WP_000036723.1.46438 WP_000036723.1.46441 WP_000036723.1.46451 WP_000036723.1.4646 WP_000036723.1.4647 WP_000036723.1.46477 WP_000036723.1.46487 WP_000036723.1.46503 WP_000036723.1.46526 WP_000036723.1.46531 WP_000036723.1.46552 WP_000036723.1.46555 WP_000036723.1.4657 WP_000036723.1.46573 WP_000036723.1.46582 WP_000036723.1.46589 WP_000036723.1.46594 WP_000036723.1.46597 WP_000036723.1.46602 WP_000036723.1.46611 WP_000036723.1.46614 WP_000036723.1.46616 WP_000036723.1.46626 WP_000036723.1.46643 WP_000036723.1.46668 WP_000036723.1.4670 WP_000036723.1.46743 WP_000036723.1.46798 WP_000036723.1.46802 WP_000036723.1.46806 WP_000036723.1.46810 WP_000036723.1.46820 WP_000036723.1.46821 WP_000036723.1.46832 WP_000036723.1.46833 WP_000036723.1.46841 WP_000036723.1.46876 WP_000036723.1.46882 WP_000036723.1.46898 WP_000036723.1.4691 WP_000036723.1.46912 WP_000036723.1.46913 WP_000036723.1.46932 WP_000036723.1.4695 WP_000036723.1.46990 WP_000036723.1.46991 WP_000036723.1.46994 WP_000036723.1.46999 WP_000036723.1.47024 WP_000036723.1.47028 WP_000036723.1.47029 WP_000036723.1.47030 WP_000036723.1.47034 WP_000036723.1.47038 WP_000036723.1.47039 WP_000036723.1.47047 WP_000036723.1.47048 WP_000036723.1.47050 WP_000036723.1.47054 WP_000036723.1.47063 WP_000036723.1.47069 WP_000036723.1.47073 WP_000036723.1.4708 WP_000036723.1.47124 WP_000036723.1.47140 WP_000036723.1.47156 WP_000036723.1.47167 WP_000036723.1.47171 WP_000036723.1.47186 WP_000036723.1.47189 WP_000036723.1.47197 WP_000036723.1.47198 WP_000036723.1.4722 WP_000036723.1.47224 WP_000036723.1.4723 WP_000036723.1.47235 WP_000036723.1.47246 WP_000036723.1.47247 WP_000036723.1.4725 WP_000036723.1.47280 WP_000036723.1.47307 WP_000036723.1.47316 WP_000036723.1.47319 WP_000036723.1.47322 WP_000036723.1.47332 WP_000036723.1.47344 WP_000036723.1.47349 WP_000036723.1.47356 WP_000036723.1.47363 WP_000036723.1.47366 WP_000036723.1.47370 WP_000036723.1.47386 WP_000036723.1.47398 WP_000036723.1.4740 WP_000036723.1.47401 WP_000036723.1.47411 WP_000036723.1.47414 WP_000036723.1.4743 WP_000036723.1.47454 WP_000036723.1.47464 WP_000036723.1.47473 WP_000036723.1.47477 WP_000036723.1.47488 WP_000036723.1.47496 WP_000036723.1.47498 WP_000036723.1.47500 WP_000036723.1.47529 WP_000036723.1.47533 WP_000036723.1.47546 WP_000036723.1.47555 WP_000036723.1.47582 WP_000036723.1.47599 WP_000036723.1.47634 WP_000036723.1.47646 WP_000036723.1.47647 WP_000036723.1.47662 WP_000036723.1.47673 WP_000036723.1.47709 WP_000036723.1.4772 WP_000036723.1.47722 WP_000036723.1.47734 WP_000036723.1.47740 WP_000036723.1.47744 WP_000036723.1.47761 WP_000036723.1.47764 WP_000036723.1.47765 WP_000036723.1.47770 WP_000036723.1.47775 WP_000036723.1.47784 WP_000036723.1.47790 WP_000036723.1.47791 WP_000036723.1.47820 WP_000036723.1.47827 WP_000036723.1.4783 WP_000036723.1.47837 WP_000036723.1.47848 WP_000036723.1.4785 WP_000036723.1.47884 WP_000036723.1.47935 WP_000036723.1.47954 WP_000036723.1.47962 WP_000036723.1.47976 WP_000036723.1.47983 WP_000036723.1.47994 WP_000036723.1.48000 WP_000036723.1.48018 WP_000036723.1.48029 WP_000036723.1.48040 WP_000036723.1.48048 WP_000036723.1.48051 WP_000036723.1.48065 WP_000036723.1.48073 WP_000036723.1.48077 WP_000036723.1.48080 WP_000036723.1.48090 WP_000036723.1.48096 WP_000036723.1.4811 WP_000036723.1.48111 WP_000036723.1.4812 WP_000036723.1.48121 WP_000036723.1.48144 WP_000036723.1.48168 WP_000036723.1.48176 WP_000036723.1.48188 WP_000036723.1.48194 WP_000036723.1.48200 WP_000036723.1.48203 WP_000036723.1.48216 WP_000036723.1.48222 WP_000036723.1.48226 WP_000036723.1.48229 WP_000036723.1.48258 WP_000036723.1.4826 WP_000036723.1.48265 WP_000036723.1.48285 WP_000036723.1.48290 WP_000036723.1.48291 WP_000036723.1.48317 WP_000036723.1.48353 WP_000036723.1.48355 WP_000036723.1.48371 WP_000036723.1.48385 WP_000036723.1.48421 WP_000036723.1.48431 WP_000036723.1.48433 WP_000036723.1.48469 WP_000036723.1.48477 WP_000036723.1.48480 WP_000036723.1.48483 WP_000036723.1.48505 WP_000036723.1.48522 WP_000036723.1.4857 WP_000036723.1.48571 WP_000036723.1.486 WP_000036723.1.48615 WP_000036723.1.48620 WP_000036723.1.48626 WP_000036723.1.48629 WP_000036723.1.48678 WP_000036723.1.48689 WP_000036723.1.48697 WP_000036723.1.4871 WP_000036723.1.48712 WP_000036723.1.4876 WP_000036723.1.48771 WP_000036723.1.48792 WP_000036723.1.48801 WP_000036723.1.48806 WP_000036723.1.48808 WP_000036723.1.48827 WP_000036723.1.48847 WP_000036723.1.48860 WP_000036723.1.48901 WP_000036723.1.48902 WP_000036723.1.48907 WP_000036723.1.48910 WP_000036723.1.4892 WP_000036723.1.48921 WP_000036723.1.48926 WP_000036723.1.48928 WP_000036723.1.48953 WP_000036723.1.48954 WP_000036723.1.48970 WP_000036723.1.48974 WP_000036723.1.49001 WP_000036723.1.49009 WP_000036723.1.49061 WP_000036723.1.49076 WP_000036723.1.49104 WP_000036723.1.49107 WP_000036723.1.49124 WP_000036723.1.49136 WP_000036723.1.49141 WP_000036723.1.49147 WP_000036723.1.49170 WP_000036723.1.49179 WP_000036723.1.49190 WP_000036723.1.49229 WP_000036723.1.49236 WP_000036723.1.49243 WP_000036723.1.49258 WP_000036723.1.49275 WP_000036723.1.4931 WP_000036723.1.49312 WP_000036723.1.49321 WP_000036723.1.49332 WP_000036723.1.49336 WP_000036723.1.49338 WP_000036723.1.49342 WP_000036723.1.49347 WP_000036723.1.49363 WP_000036723.1.49376 WP_000036723.1.49401 WP_000036723.1.49412 WP_000036723.1.49446 WP_000036723.1.49459 WP_000036723.1.49464 WP_000036723.1.49481 WP_000036723.1.49482 WP_000036723.1.49483 WP_000036723.1.4949 WP_000036723.1.49496 WP_000036723.1.49521 WP_000036723.1.49522 WP_000036723.1.4953 WP_000036723.1.49531 WP_000036723.1.49537 WP_000036723.1.49546 WP_000036723.1.49558 WP_000036723.1.49567 WP_000036723.1.49594 WP_000036723.1.49599 WP_000036723.1.49615 WP_000036723.1.49621 WP_000036723.1.49625 WP_000036723.1.49645 WP_000036723.1.49655 WP_000036723.1.49661 WP_000036723.1.49662 WP_000036723.1.49675 WP_000036723.1.49684 WP_000036723.1.497 WP_000036723.1.49712 WP_000036723.1.49722 WP_000036723.1.49733 WP_000036723.1.49740 WP_000036723.1.49747 WP_000036723.1.49768 WP_000036723.1.49771 WP_000036723.1.49774 WP_000036723.1.49783 WP_000036723.1.49788 WP_000036723.1.49794 WP_000036723.1.49820 WP_000036723.1.49823 WP_000036723.1.4985 WP_000036723.1.49856 WP_000036723.1.49861 WP_000036723.1.49879 WP_000036723.1.49883 WP_000036723.1.49884 WP_000036723.1.49900 WP_000036723.1.49902 WP_000036723.1.49941 WP_000036723.1.49950 WP_000036723.1.49954 WP_000036723.1.49972 WP_000036723.1.49987 WP_000036723.1.50006 WP_000036723.1.50008 WP_000036723.1.5003 WP_000036723.1.50036 WP_000036723.1.50056 WP_000036723.1.50058 WP_000036723.1.50078 WP_000036723.1.50098 WP_000036723.1.50110 WP_000036723.1.50113 WP_000036723.1.50119 WP_000036723.1.50146 WP_000036723.1.5017 WP_000036723.1.50179 WP_000036723.1.50182 WP_000036723.1.50187 WP_000036723.1.50191 WP_000036723.1.50196 WP_000036723.1.50228 WP_000036723.1.50230 WP_000036723.1.50258 WP_000036723.1.50262 WP_000036723.1.50266 WP_000036723.1.50269 WP_000036723.1.50270 WP_000036723.1.50278 WP_000036723.1.50304 WP_000036723.1.50345 WP_000036723.1.50353 WP_000036723.1.50358 WP_000036723.1.50361 WP_000036723.1.50366 WP_000036723.1.5037 WP_000036723.1.50380 WP_000036723.1.5040 WP_000036723.1.50412 WP_000036723.1.50418 WP_000036723.1.50427 WP_000036723.1.50452 WP_000036723.1.5046 WP_000036723.1.50548 WP_000036723.1.50549 WP_000036723.1.5056 WP_000036723.1.50564 WP_000036723.1.50579 WP_000036723.1.50585 WP_000036723.1.50586 WP_000036723.1.50608 WP_000036723.1.50616 WP_000036723.1.50627 WP_000036723.1.5064 WP_000036723.1.5067 WP_000036723.1.50690 WP_000036723.1.50700 WP_000036723.1.50715 WP_000036723.1.50717 WP_000036723.1.50725 WP_000036723.1.50728 WP_000036723.1.50762 WP_000036723.1.50887 WP_000036723.1.50925 WP_000036723.1.50936 WP_000036723.1.50939 WP_000036723.1.50947 WP_000036723.1.5095 WP_000036723.1.50969 WP_000036723.1.50986 WP_000036723.1.50988 WP_000036723.1.50990 WP_000036723.1.50996 WP_000036723.1.51013 WP_000036723.1.51027 WP_000036723.1.51042 WP_000036723.1.51058 WP_000036723.1.5106 WP_000036723.1.511 WP_000036723.1.51109 WP_000036723.1.51154 WP_000036723.1.51170 WP_000036723.1.51171 WP_000036723.1.51172 WP_000036723.1.51175 WP_000036723.1.51180 WP_000036723.1.51190 WP_000036723.1.51201 WP_000036723.1.51203 WP_000036723.1.51206 WP_000036723.1.51211 WP_000036723.1.5124 WP_000036723.1.51248 WP_000036723.1.51253 WP_000036723.1.51255 WP_000036723.1.51260 WP_000036723.1.51278 WP_000036723.1.5128 WP_000036723.1.51283 WP_000036723.1.51299 WP_000036723.1.51300 WP_000036723.1.51307 WP_000036723.1.51323 WP_000036723.1.51325 WP_000036723.1.51330 WP_000036723.1.51336 WP_000036723.1.51360 WP_000036723.1.51380 WP_000036723.1.51392 WP_000036723.1.51425 WP_000036723.1.51426 WP_000036723.1.51427 WP_000036723.1.51430 WP_000036723.1.51441 WP_000036723.1.5146 WP_000036723.1.51462 WP_000036723.1.51490 WP_000036723.1.51495 WP_000036723.1.51505 WP_000036723.1.51525 WP_000036723.1.5153 WP_000036723.1.51537 WP_000036723.1.51539 WP_000036723.1.51548 WP_000036723.1.51552 WP_000036723.1.5157 WP_000036723.1.5158 WP_000036723.1.51580 WP_000036723.1.51587 WP_000036723.1.51596 WP_000036723.1.51600 WP_000036723.1.51607 WP_000036723.1.51629 WP_000036723.1.51643 WP_000036723.1.51690 WP_000036723.1.51693 WP_000036723.1.51707 WP_000036723.1.51718 WP_000036723.1.5172 WP_000036723.1.51736 WP_000036723.1.51757 WP_000036723.1.51760 WP_000036723.1.51784 WP_000036723.1.518 WP_000036723.1.51804 WP_000036723.1.51834 WP_000036723.1.51837 WP_000036723.1.51839 WP_000036723.1.51873 WP_000036723.1.51881 WP_000036723.1.51896 WP_000036723.1.51899 WP_000036723.1.51944 WP_000036723.1.51949 WP_000036723.1.51968 WP_000036723.1.51979 WP_000036723.1.51985 WP_000036723.1.51988 WP_000036723.1.5199 WP_000036723.1.51999 WP_000036723.1.52002 WP_000036723.1.52020 WP_000036723.1.52039 WP_000036723.1.52048 WP_000036723.1.52062 WP_000036723.1.52076 WP_000036723.1.52085 WP_000036723.1.52098 WP_000036723.1.52126 WP_000036723.1.52127 WP_000036723.1.52135 WP_000036723.1.52137 WP_000036723.1.5217 WP_000036723.1.52171 WP_000036723.1.52186 WP_000036723.1.52200 WP_000036723.1.52211 WP_000036723.1.52213 WP_000036723.1.52214 WP_000036723.1.52230 WP_000036723.1.52243 WP_000036723.1.52249 WP_000036723.1.52257 WP_000036723.1.52258 WP_000036723.1.5227 WP_000036723.1.52270 WP_000036723.1.52271 WP_000036723.1.52272 WP_000036723.1.52299 WP_000036723.1.52305 WP_000036723.1.52313 WP_000036723.1.52333 WP_000036723.1.52363 WP_000036723.1.52378 WP_000036723.1.5239 WP_000036723.1.52399 WP_000036723.1.52406 WP_000036723.1.52419 WP_000036723.1.52421 WP_000036723.1.52492 WP_000036723.1.52496 WP_000036723.1.52524 WP_000036723.1.52542 WP_000036723.1.52544 WP_000036723.1.52558 WP_000036723.1.52568 WP_000036723.1.52601 WP_000036723.1.52612 WP_000036723.1.52631 WP_000036723.1.5265 WP_000036723.1.52662 WP_000036723.1.52691 WP_000036723.1.52704 WP_000036723.1.52710 WP_000036723.1.5272 WP_000036723.1.52735 WP_000036723.1.52762 WP_000036723.1.52771 WP_000036723.1.52774 WP_000036723.1.52777 WP_000036723.1.52780 WP_000036723.1.52781 WP_000036723.1.52801 WP_000036723.1.52804 WP_000036723.1.52844 WP_000036723.1.52846 WP_000036723.1.5285 WP_000036723.1.52852 WP_000036723.1.52853 WP_000036723.1.52855 WP_000036723.1.52881 WP_000036723.1.52883 WP_000036723.1.52895 WP_000036723.1.52908 WP_000036723.1.5291 WP_000036723.1.52913 WP_000036723.1.52933 WP_000036723.1.52945 WP_000036723.1.52962 WP_000036723.1.52995 WP_000036723.1.53012 WP_000036723.1.53020 WP_000036723.1.53021 WP_000036723.1.53027 WP_000036723.1.53084 WP_000036723.1.53095 WP_000036723.1.5310 WP_000036723.1.53110 WP_000036723.1.53123 WP_000036723.1.53155 WP_000036723.1.53162 WP_000036723.1.53181 WP_000036723.1.532 WP_000036723.1.53211 WP_000036723.1.53223 WP_000036723.1.53228 WP_000036723.1.53242 WP_000036723.1.53244 WP_000036723.1.53252 WP_000036723.1.53262 WP_000036723.1.53270 WP_000036723.1.53327 WP_000036723.1.53356 WP_000036723.1.53360 WP_000036723.1.53364 WP_000036723.1.53377 WP_000036723.1.53401 WP_000036723.1.53410 WP_000036723.1.53415 WP_000036723.1.5342 WP_000036723.1.53428 WP_000036723.1.53431 WP_000036723.1.53482 WP_000036723.1.53505 WP_000036723.1.53537 WP_000036723.1.53545 WP_000036723.1.53556 WP_000036723.1.53557 WP_000036723.1.53587 WP_000036723.1.53589 WP_000036723.1.53590 WP_000036723.1.53592 WP_000036723.1.53594 WP_000036723.1.53645 WP_000036723.1.53649 WP_000036723.1.53687 WP_000036723.1.53690 WP_000036723.1.53693 WP_000036723.1.53706 WP_000036723.1.53769 WP_000036723.1.53809 WP_000036723.1.53810 WP_000036723.1.53811 WP_000036723.1.53845 WP_000036723.1.53863 WP_000036723.1.53866 WP_000036723.1.53878 WP_000036723.1.53884 WP_000036723.1.5391 WP_000036723.1.5393 WP_000036723.1.53931 WP_000036723.1.53940 WP_000036723.1.53966 WP_000036723.1.53972 WP_000036723.1.53978 WP_000036723.1.53991 WP_000036723.1.53994 WP_000036723.1.54002 WP_000036723.1.54013 WP_000036723.1.54023 WP_000036723.1.54024 WP_000036723.1.54028 WP_000036723.1.54032 WP_000036723.1.54051 WP_000036723.1.54072 WP_000036723.1.54091 WP_000036723.1.54095 WP_000036723.1.54102 WP_000036723.1.54104 WP_000036723.1.54144 WP_000036723.1.54169 WP_000036723.1.54185 WP_000036723.1.54188 WP_000036723.1.54202 WP_000036723.1.54208 WP_000036723.1.54213 WP_000036723.1.54263 WP_000036723.1.54307 WP_000036723.1.54313 WP_000036723.1.54317 WP_000036723.1.54328 WP_000036723.1.54329 WP_000036723.1.5433 WP_000036723.1.5434 WP_000036723.1.54344 WP_000036723.1.54359 WP_000036723.1.54388 WP_000036723.1.54394 WP_000036723.1.5441 WP_000036723.1.54411 WP_000036723.1.54418 WP_000036723.1.54429 WP_000036723.1.54439 WP_000036723.1.54454 WP_000036723.1.54463 WP_000036723.1.54476 WP_000036723.1.54507 WP_000036723.1.54524 WP_000036723.1.54534 WP_000036723.1.54546 WP_000036723.1.54585 WP_000036723.1.54590 WP_000036723.1.54591 WP_000036723.1.5460 WP_000036723.1.54601 WP_000036723.1.54602 WP_000036723.1.54605 WP_000036723.1.5461 WP_000036723.1.54617 WP_000036723.1.54620 WP_000036723.1.54625 WP_000036723.1.54638 WP_000036723.1.54643 WP_000036723.1.5467 WP_000036723.1.54695 WP_000036723.1.5470 WP_000036723.1.54708 WP_000036723.1.54725 WP_000036723.1.54729 WP_000036723.1.54754 WP_000036723.1.54760 WP_000036723.1.54769 WP_000036723.1.5478 WP_000036723.1.5479 WP_000036723.1.54798 WP_000036723.1.54817 WP_000036723.1.54829 WP_000036723.1.5486 WP_000036723.1.54875 WP_000036723.1.54883 WP_000036723.1.54918 WP_000036723.1.54927 WP_000036723.1.54940 WP_000036723.1.54941 WP_000036723.1.54972 WP_000036723.1.54981 WP_000036723.1.54989 WP_000036723.1.54991 WP_000036723.1.54993 WP_000036723.1.55003 WP_000036723.1.55005 WP_000036723.1.55009 WP_000036723.1.55041 WP_000036723.1.55070 WP_000036723.1.55112 WP_000036723.1.55115 WP_000036723.1.5512 WP_000036723.1.55134 WP_000036723.1.55144 WP_000036723.1.55149 WP_000036723.1.55151 WP_000036723.1.55177 WP_000036723.1.55179 WP_000036723.1.55185 WP_000036723.1.55197 WP_000036723.1.5520 WP_000036723.1.55203 WP_000036723.1.55222 WP_000036723.1.55226 WP_000036723.1.55273 WP_000036723.1.55275 WP_000036723.1.55286 WP_000036723.1.55338 WP_000036723.1.55342 WP_000036723.1.55357 WP_000036723.1.55359 WP_000036723.1.55374 WP_000036723.1.55381 WP_000036723.1.55417 WP_000036723.1.55420 WP_000036723.1.55424 WP_000036723.1.55425 WP_000036723.1.5546 WP_000036723.1.55466 WP_000036723.1.55472 WP_000036723.1.55489 WP_000036723.1.55492 WP_000036723.1.55507 WP_000036723.1.55529 WP_000036723.1.55550 WP_000036723.1.55551 WP_000036723.1.55552 WP_000036723.1.55556 WP_000036723.1.55560 WP_000036723.1.55563 WP_000036723.1.55571 WP_000036723.1.55574 WP_000036723.1.55597 WP_000036723.1.55608 WP_000036723.1.5561 WP_000036723.1.55629 WP_000036723.1.5570 WP_000036723.1.55709 WP_000036723.1.55720 WP_000036723.1.55730 WP_000036723.1.55731 WP_000036723.1.55744 WP_000036723.1.55757 WP_000036723.1.55787 WP_000036723.1.55790 WP_000036723.1.55791 WP_000036723.1.55808 WP_000036723.1.55820 WP_000036723.1.55825 WP_000036723.1.55838 WP_000036723.1.55844 WP_000036723.1.55868 WP_000036723.1.55870 WP_000036723.1.55888 WP_000036723.1.55892 WP_000036723.1.55896 WP_000036723.1.55897 WP_000036723.1.55936 WP_000036723.1.55981 WP_000036723.1.55988 WP_000036723.1.55990 WP_000036723.1.56033 WP_000036723.1.56040 WP_000036723.1.56047 WP_000036723.1.56072 WP_000036723.1.561 WP_000036723.1.56122 WP_000036723.1.56139 WP_000036723.1.5614 WP_000036723.1.56142 WP_000036723.1.56149 WP_000036723.1.56151 WP_000036723.1.5616 WP_000036723.1.56164 WP_000036723.1.56169 WP_000036723.1.56177 WP_000036723.1.56193 WP_000036723.1.56197 WP_000036723.1.562 WP_000036723.1.56216 WP_000036723.1.56278 WP_000036723.1.56285 WP_000036723.1.56293 WP_000036723.1.56302 WP_000036723.1.5632 WP_000036723.1.56338 WP_000036723.1.56358 WP_000036723.1.56371 WP_000036723.1.5639 WP_000036723.1.56390 WP_000036723.1.56392 WP_000036723.1.56402 WP_000036723.1.56436 WP_000036723.1.56439 WP_000036723.1.56446 WP_000036723.1.56457 WP_000036723.1.5646 WP_000036723.1.56469 WP_000036723.1.56481 WP_000036723.1.56489 WP_000036723.1.56491 WP_000036723.1.56501 WP_000036723.1.56502 WP_000036723.1.56513 WP_000036723.1.56528 WP_000036723.1.56543 WP_000036723.1.56554 WP_000036723.1.56571 WP_000036723.1.56573 WP_000036723.1.56586 WP_000036723.1.56650 WP_000036723.1.56662 WP_000036723.1.56665 WP_000036723.1.56680 WP_000036723.1.56689 WP_000036723.1.5670 WP_000036723.1.56704 WP_000036723.1.56713 WP_000036723.1.56714 WP_000036723.1.56721 WP_000036723.1.56742 WP_000036723.1.56776 WP_000036723.1.56786 WP_000036723.1.56787 WP_000036723.1.56789 WP_000036723.1.56799 WP_000036723.1.56821 WP_000036723.1.56830 WP_000036723.1.56835 WP_000036723.1.56846 WP_000036723.1.5685 WP_000036723.1.56871 WP_000036723.1.56882 WP_000036723.1.56885 WP_000036723.1.56932 WP_000036723.1.56933 WP_000036723.1.56934 WP_000036723.1.56936 WP_000036723.1.56937 WP_000036723.1.56941 WP_000036723.1.56978 WP_000036723.1.56980 WP_000036723.1.57011 WP_000036723.1.57032 WP_000036723.1.57051 WP_000036723.1.57068 WP_000036723.1.57071 WP_000036723.1.57072 WP_000036723.1.57079 WP_000036723.1.57086 WP_000036723.1.57100 WP_000036723.1.57124 WP_000036723.1.57150 WP_000036723.1.57159 WP_000036723.1.57180 WP_000036723.1.57181 WP_000036723.1.57182 WP_000036723.1.57185 WP_000036723.1.57197 WP_000036723.1.57202 WP_000036723.1.57213 WP_000036723.1.57216 WP_000036723.1.57222 WP_000036723.1.57254 WP_000036723.1.57266 WP_000036723.1.57278 WP_000036723.1.57280 WP_000036723.1.57281 WP_000036723.1.57348 WP_000036723.1.57349 WP_000036723.1.57386 WP_000036723.1.57395 WP_000036723.1.57401 WP_000036723.1.57403 WP_000036723.1.57410 WP_000036723.1.57414 WP_000036723.1.5742 WP_000036723.1.57432 WP_000036723.1.57438 WP_000036723.1.57451 WP_000036723.1.57453 WP_000036723.1.57466 WP_000036723.1.5748 WP_000036723.1.57487 WP_000036723.1.57492 WP_000036723.1.57517 WP_000036723.1.57538 WP_000036723.1.57539 WP_000036723.1.5755 WP_000036723.1.57550 WP_000036723.1.57558 WP_000036723.1.57588 WP_000036723.1.57608 WP_000036723.1.57610 WP_000036723.1.57629 WP_000036723.1.57638 WP_000036723.1.5764 WP_000036723.1.57646 WP_000036723.1.57659 WP_000036723.1.57663 WP_000036723.1.57669 WP_000036723.1.57719 WP_000036723.1.57738 WP_000036723.1.57812 WP_000036723.1.57814 WP_000036723.1.57832 WP_000036723.1.57836 WP_000036723.1.57846 WP_000036723.1.57851 WP_000036723.1.5786 WP_000036723.1.5787 WP_000036723.1.57898 WP_000036723.1.57904 WP_000036723.1.57920 WP_000036723.1.57982 WP_000036723.1.57983 WP_000036723.1.57994 WP_000036723.1.58001 WP_000036723.1.58009 WP_000036723.1.58022 WP_000036723.1.58045 WP_000036723.1.58048 WP_000036723.1.58057 WP_000036723.1.58060 WP_000036723.1.58080 WP_000036723.1.58092 WP_000036723.1.58094 WP_000036723.1.58097 WP_000036723.1.58098 WP_000036723.1.5810 WP_000036723.1.58107 WP_000036723.1.58128 WP_000036723.1.58136 WP_000036723.1.58143 WP_000036723.1.58146 WP_000036723.1.58163 WP_000036723.1.58169 WP_000036723.1.58172 WP_000036723.1.58206 WP_000036723.1.58226 WP_000036723.1.58232 WP_000036723.1.58233 WP_000036723.1.58238 WP_000036723.1.58244 WP_000036723.1.58248 WP_000036723.1.58267 WP_000036723.1.58289 WP_000036723.1.58292 WP_000036723.1.58316 WP_000036723.1.58336 WP_000036723.1.58340 WP_000036723.1.58345 WP_000036723.1.58371 WP_000036723.1.58384 WP_000036723.1.584 WP_000036723.1.58401 WP_000036723.1.58414 WP_000036723.1.5842 WP_000036723.1.58420 WP_000036723.1.58423 WP_000036723.1.58424 WP_000036723.1.58440 WP_000036723.1.58444 WP_000036723.1.58445 WP_000036723.1.58449 WP_000036723.1.58459 WP_000036723.1.58475 WP_000036723.1.58493 WP_000036723.1.585 WP_000036723.1.58507 WP_000036723.1.58514 WP_000036723.1.5852 WP_000036723.1.58528 WP_000036723.1.58547 WP_000036723.1.58552 WP_000036723.1.58560 WP_000036723.1.58572 WP_000036723.1.58582 WP_000036723.1.58609 WP_000036723.1.58617 WP_000036723.1.58622 WP_000036723.1.58657 WP_000036723.1.58692 WP_000036723.1.58705 WP_000036723.1.58707 WP_000036723.1.58723 WP_000036723.1.58737 WP_000036723.1.58799 WP_000036723.1.58837 WP_000036723.1.58867 WP_000036723.1.58870 WP_000036723.1.58940 WP_000036723.1.58942 WP_000036723.1.58951 WP_000036723.1.58958 WP_000036723.1.58976 WP_000036723.1.58977 WP_000036723.1.58983 WP_000036723.1.58999 WP_000036723.1.59024 WP_000036723.1.59026 WP_000036723.1.59035 WP_000036723.1.59038 WP_000036723.1.59047 WP_000036723.1.59055 WP_000036723.1.59060 WP_000036723.1.59073 WP_000036723.1.59083 WP_000036723.1.59119 WP_000036723.1.59165 WP_000036723.1.59174 WP_000036723.1.59190 WP_000036723.1.59226 WP_000036723.1.59263 WP_000036723.1.5927 WP_000036723.1.59280 WP_000036723.1.59291 WP_000036723.1.59292 WP_000036723.1.59293 WP_000036723.1.59302 WP_000036723.1.59306 WP_000036723.1.59359 WP_000036723.1.59374 WP_000036723.1.59395 WP_000036723.1.59396 WP_000036723.1.59407 WP_000036723.1.59409 WP_000036723.1.5942 WP_000036723.1.59425 WP_000036723.1.59426 WP_000036723.1.59434 WP_000036723.1.59470 WP_000036723.1.59483 WP_000036723.1.59491 WP_000036723.1.59533 WP_000036723.1.59553 WP_000036723.1.59572 WP_000036723.1.59577 WP_000036723.1.59579 WP_000036723.1.59590 WP_000036723.1.59611 WP_000036723.1.59613 WP_000036723.1.59615 WP_000036723.1.59621 WP_000036723.1.5963 WP_000036723.1.59638 WP_000036723.1.5965 WP_000036723.1.59660 WP_000036723.1.59679 WP_000036723.1.59699 WP_000036723.1.59714 WP_000036723.1.59717 WP_000036723.1.59730 WP_000036723.1.59733 WP_000036723.1.59737 WP_000036723.1.59745 WP_000036723.1.59748 WP_000036723.1.59756 WP_000036723.1.59781 WP_000036723.1.59782 WP_000036723.1.59788 WP_000036723.1.59791 WP_000036723.1.59793 WP_000036723.1.59815 WP_000036723.1.59823 WP_000036723.1.59836 WP_000036723.1.59838 WP_000036723.1.59853 WP_000036723.1.59858 WP_000036723.1.59877 WP_000036723.1.59894 WP_000036723.1.59900 WP_000036723.1.59905 WP_000036723.1.59912 WP_000036723.1.59931 WP_000036723.1.59932 WP_000036723.1.59959 WP_000036723.1.59970 WP_000036723.1.59980 WP_000036723.1.59981 WP_000036723.1.59989 WP_000036723.1.59998 WP_000036723.1.6002 WP_000036723.1.60023 WP_000036723.1.60031 WP_000036723.1.60042 WP_000036723.1.60043 WP_000036723.1.60048 WP_000036723.1.60067 WP_000036723.1.60070 WP_000036723.1.60095 WP_000036723.1.60096 WP_000036723.1.60110 WP_000036723.1.60117 WP_000036723.1.6013 WP_000036723.1.60133 WP_000036723.1.60151 WP_000036723.1.6022 WP_000036723.1.60225 WP_000036723.1.60228 WP_000036723.1.60235 WP_000036723.1.60304 WP_000036723.1.60325 WP_000036723.1.60337 WP_000036723.1.60342 WP_000036723.1.60343 WP_000036723.1.60350 WP_000036723.1.60373 WP_000036723.1.60374 WP_000036723.1.60387 WP_000036723.1.60411 WP_000036723.1.60453 WP_000036723.1.60457 WP_000036723.1.60461 WP_000036723.1.60477 WP_000036723.1.60498 WP_000036723.1.60505 WP_000036723.1.60544 WP_000036723.1.60550 WP_000036723.1.60555 WP_000036723.1.60567 WP_000036723.1.60576 WP_000036723.1.6059 WP_000036723.1.60591 WP_000036723.1.60606 WP_000036723.1.6061 WP_000036723.1.60613 WP_000036723.1.60630 WP_000036723.1.6064 WP_000036723.1.60647 WP_000036723.1.60654 WP_000036723.1.6066 WP_000036723.1.6068 WP_000036723.1.60698 WP_000036723.1.60717 WP_000036723.1.60732 WP_000036723.1.60744 WP_000036723.1.60761 WP_000036723.1.60764 WP_000036723.1.60784 WP_000036723.1.60805 WP_000036723.1.60832 WP_000036723.1.60835 WP_000036723.1.60872 WP_000036723.1.60895 WP_000036723.1.60901 WP_000036723.1.60925 WP_000036723.1.60927 WP_000036723.1.60935 WP_000036723.1.6094 WP_000036723.1.60974 WP_000036723.1.61005 WP_000036723.1.61006 WP_000036723.1.61008 WP_000036723.1.61035 WP_000036723.1.61039 WP_000036723.1.61046 WP_000036723.1.61058 WP_000036723.1.6106 WP_000036723.1.61096 WP_000036723.1.61097 WP_000036723.1.61099 WP_000036723.1.6110 WP_000036723.1.61102 WP_000036723.1.61108 WP_000036723.1.61112 WP_000036723.1.61121 WP_000036723.1.61132 WP_000036723.1.61170 WP_000036723.1.61174 WP_000036723.1.61175 WP_000036723.1.61181 WP_000036723.1.61183 WP_000036723.1.61186 WP_000036723.1.61225 WP_000036723.1.61241 WP_000036723.1.61245 WP_000036723.1.61253 WP_000036723.1.61284 WP_000036723.1.61292 WP_000036723.1.613 WP_000036723.1.61360 WP_000036723.1.61364 WP_000036723.1.6138 WP_000036723.1.61398 WP_000036723.1.61442 WP_000036723.1.61445 WP_000036723.1.61480 WP_000036723.1.615 WP_000036723.1.61505 WP_000036723.1.61512 WP_000036723.1.61517 WP_000036723.1.61524 WP_000036723.1.61551 WP_000036723.1.61608 WP_000036723.1.61617 WP_000036723.1.61623 WP_000036723.1.61636 WP_000036723.1.61663 WP_000036723.1.61739 WP_000036723.1.61758 WP_000036723.1.61770 WP_000036723.1.61779 WP_000036723.1.61789 WP_000036723.1.618 WP_000036723.1.61806 WP_000036723.1.61822 WP_000036723.1.61835 WP_000036723.1.61853 WP_000036723.1.61858 WP_000036723.1.61874 WP_000036723.1.61926 WP_000036723.1.61939 WP_000036723.1.61948 WP_000036723.1.61949 WP_000036723.1.61955 WP_000036723.1.61957 WP_000036723.1.61985 WP_000036723.1.62038 WP_000036723.1.62041 WP_000036723.1.62043 WP_000036723.1.62091 WP_000036723.1.62099 WP_000036723.1.62102 WP_000036723.1.6212 WP_000036723.1.62135 WP_000036723.1.62157 WP_000036723.1.62182 WP_000036723.1.62207 WP_000036723.1.62236 WP_000036723.1.62262 WP_000036723.1.62264 WP_000036723.1.62266 WP_000036723.1.62273 WP_000036723.1.62282 WP_000036723.1.62290 WP_000036723.1.62296 WP_000036723.1.62322 WP_000036723.1.62337 WP_000036723.1.62358 WP_000036723.1.62424 WP_000036723.1.62447 WP_000036723.1.62454 WP_000036723.1.62460 WP_000036723.1.62480 WP_000036723.1.62481 WP_000036723.1.62487 WP_000036723.1.62503 WP_000036723.1.62514 WP_000036723.1.62529 WP_000036723.1.62541 WP_000036723.1.62555 WP_000036723.1.62586 WP_000036723.1.6261 WP_000036723.1.62612 WP_000036723.1.62631 WP_000036723.1.62642 WP_000036723.1.62646 WP_000036723.1.62668 WP_000036723.1.62675 WP_000036723.1.62681 WP_000036723.1.62714 WP_000036723.1.62735 WP_000036723.1.62750 WP_000036723.1.62762 WP_000036723.1.62769 WP_000036723.1.62780 WP_000036723.1.62784 WP_000036723.1.62787 WP_000036723.1.62788 WP_000036723.1.62818 WP_000036723.1.62819 WP_000036723.1.6282 WP_000036723.1.62840 WP_000036723.1.62843 WP_000036723.1.62850 WP_000036723.1.62851 WP_000036723.1.62866 WP_000036723.1.62885 WP_000036723.1.62888 WP_000036723.1.62914 WP_000036723.1.62919 WP_000036723.1.6293 WP_000036723.1.62931 WP_000036723.1.62951 WP_000036723.1.62959 WP_000036723.1.62989 WP_000036723.1.6299 WP_000036723.1.6307 WP_000036723.1.63078 WP_000036723.1.63113 WP_000036723.1.63167 WP_000036723.1.63177 WP_000036723.1.63189 WP_000036723.1.6323 WP_000036723.1.63246 WP_000036723.1.63271 WP_000036723.1.63285 WP_000036723.1.63287 WP_000036723.1.63305 WP_000036723.1.6331 WP_000036723.1.63310 WP_000036723.1.63330 WP_000036723.1.6334 WP_000036723.1.63350 WP_000036723.1.6337 WP_000036723.1.63370 WP_000036723.1.63374 WP_000036723.1.63393 WP_000036723.1.63419 WP_000036723.1.63433 WP_000036723.1.63437 WP_000036723.1.63444 WP_000036723.1.63445 WP_000036723.1.63453 WP_000036723.1.63465 WP_000036723.1.63466 WP_000036723.1.63467 WP_000036723.1.63470 WP_000036723.1.63478 WP_000036723.1.6348 WP_000036723.1.63484 WP_000036723.1.63487 WP_000036723.1.63491 WP_000036723.1.63496 WP_000036723.1.63536 WP_000036723.1.63554 WP_000036723.1.63556 WP_000036723.1.63563 WP_000036723.1.63576 WP_000036723.1.63586 WP_000036723.1.63604 WP_000036723.1.63608 WP_000036723.1.63612 WP_000036723.1.63615 WP_000036723.1.6364 WP_000036723.1.63666 WP_000036723.1.63679 WP_000036723.1.63683 WP_000036723.1.63703 WP_000036723.1.63721 WP_000036723.1.63746 WP_000036723.1.63810 WP_000036723.1.63814 WP_000036723.1.63821 WP_000036723.1.63856 WP_000036723.1.63872 WP_000036723.1.63944 WP_000036723.1.63957 WP_000036723.1.63964 WP_000036723.1.63969 WP_000036723.1.63990 WP_000036723.1.64008 WP_000036723.1.64014 WP_000036723.1.64030 WP_000036723.1.64040 WP_000036723.1.64050 WP_000036723.1.64053 WP_000036723.1.64074 WP_000036723.1.64080 WP_000036723.1.64086 WP_000036723.1.64110 WP_000036723.1.64138 WP_000036723.1.64150 WP_000036723.1.64153 WP_000036723.1.6416 WP_000036723.1.64161 WP_000036723.1.64165 WP_000036723.1.64175 WP_000036723.1.64180 WP_000036723.1.64190 WP_000036723.1.64193 WP_000036723.1.64285 WP_000036723.1.64286 WP_000036723.1.643 WP_000036723.1.6431 WP_000036723.1.64312 WP_000036723.1.64321 WP_000036723.1.64330 WP_000036723.1.64337 WP_000036723.1.64353 WP_000036723.1.64355 WP_000036723.1.64356 WP_000036723.1.64371 WP_000036723.1.64380 WP_000036723.1.64391 WP_000036723.1.6441 WP_000036723.1.64438 WP_000036723.1.6444 WP_000036723.1.6445 WP_000036723.1.64458 WP_000036723.1.6446 WP_000036723.1.64519 WP_000036723.1.64520 WP_000036723.1.64528 WP_000036723.1.64547 WP_000036723.1.64563 WP_000036723.1.64621 WP_000036723.1.64657 WP_000036723.1.64670 WP_000036723.1.64693 WP_000036723.1.64695 WP_000036723.1.647 WP_000036723.1.64707 WP_000036723.1.64712 WP_000036723.1.64746 WP_000036723.1.64749 WP_000036723.1.64784 WP_000036723.1.64789 WP_000036723.1.64793 WP_000036723.1.64840 WP_000036723.1.64875 WP_000036723.1.64881 WP_000036723.1.64901 WP_000036723.1.64912 WP_000036723.1.64926 WP_000036723.1.64930 WP_000036723.1.64939 WP_000036723.1.64946 WP_000036723.1.64970 WP_000036723.1.6499 WP_000036723.1.64990 WP_000036723.1.6500 WP_000036723.1.65023 WP_000036723.1.65035 WP_000036723.1.65040 WP_000036723.1.65056 WP_000036723.1.65061 WP_000036723.1.65084 WP_000036723.1.65085 WP_000036723.1.65097 WP_000036723.1.651 WP_000036723.1.65104 WP_000036723.1.6511 WP_000036723.1.65110 WP_000036723.1.65114 WP_000036723.1.65116 WP_000036723.1.65118 WP_000036723.1.65122 WP_000036723.1.65151 WP_000036723.1.65155 WP_000036723.1.65179 WP_000036723.1.65194 WP_000036723.1.65206 WP_000036723.1.65240 WP_000036723.1.65256 WP_000036723.1.6527 WP_000036723.1.65271 WP_000036723.1.65286 WP_000036723.1.65296 WP_000036723.1.65305 WP_000036723.1.65306 WP_000036723.1.65353 WP_000036723.1.65355 WP_000036723.1.65364 WP_000036723.1.65366 WP_000036723.1.6537 WP_000036723.1.65370 WP_000036723.1.65372 WP_000036723.1.654 WP_000036723.1.65405 WP_000036723.1.65408 WP_000036723.1.65413 WP_000036723.1.65415 WP_000036723.1.65456 WP_000036723.1.65484 WP_000036723.1.65493 WP_000036723.1.65531 WP_000036723.1.65546 WP_000036723.1.65565 WP_000036723.1.65571 WP_000036723.1.65581 WP_000036723.1.65596 WP_000036723.1.65606 WP_000036723.1.6563 WP_000036723.1.65662 WP_000036723.1.65672 WP_000036723.1.65749 WP_000036723.1.6576 WP_000036723.1.65762 WP_000036723.1.65834 WP_000036723.1.6587 WP_000036723.1.65875 WP_000036723.1.65898 WP_000036723.1.65912 WP_000036723.1.65954 WP_000036723.1.65957 WP_000036723.1.65961 WP_000036723.1.65962 WP_000036723.1.65963 WP_000036723.1.65976 WP_000036723.1.65978 WP_000036723.1.65988 WP_000036723.1.6599 WP_000036723.1.65991 WP_000036723.1.66001 WP_000036723.1.66007 WP_000036723.1.66016 WP_000036723.1.66017 WP_000036723.1.66022 WP_000036723.1.66033 WP_000036723.1.6604 WP_000036723.1.66044 WP_000036723.1.66050 WP_000036723.1.66059 WP_000036723.1.66071 WP_000036723.1.6609 WP_000036723.1.66094 WP_000036723.1.66100 WP_000036723.1.66104 WP_000036723.1.66105 WP_000036723.1.66121 WP_000036723.1.66127 WP_000036723.1.66161 WP_000036723.1.6618 WP_000036723.1.66181 WP_000036723.1.66187 WP_000036723.1.66197 WP_000036723.1.66251 WP_000036723.1.66255 WP_000036723.1.66280 WP_000036723.1.66288 WP_000036723.1.66290 WP_000036723.1.66295 WP_000036723.1.66327 WP_000036723.1.6635 WP_000036723.1.66376 WP_000036723.1.66387 WP_000036723.1.66389 WP_000036723.1.66392 WP_000036723.1.66395 WP_000036723.1.66412 WP_000036723.1.66421 WP_000036723.1.66448 WP_000036723.1.66501 WP_000036723.1.66511 WP_000036723.1.66523 WP_000036723.1.66531 WP_000036723.1.6654 WP_000036723.1.66550 WP_000036723.1.66559 WP_000036723.1.66566 WP_000036723.1.66579 WP_000036723.1.66624 WP_000036723.1.66644 WP_000036723.1.6665 WP_000036723.1.6666 WP_000036723.1.66667 WP_000036723.1.66668 WP_000036723.1.66700 WP_000036723.1.66706 WP_000036723.1.66708 WP_000036723.1.66719 WP_000036723.1.66727 WP_000036723.1.66751 WP_000036723.1.66758 WP_000036723.1.6676 WP_000036723.1.66783 WP_000036723.1.66787 WP_000036723.1.66794 WP_000036723.1.66795 WP_000036723.1.66796 WP_000036723.1.66849 WP_000036723.1.66873 WP_000036723.1.66922 WP_000036723.1.66926 WP_000036723.1.66933 WP_000036723.1.66948 WP_000036723.1.66978 WP_000036723.1.6698 WP_000036723.1.66984 WP_000036723.1.6701 WP_000036723.1.67018 WP_000036723.1.67021 WP_000036723.1.67022 WP_000036723.1.67026 WP_000036723.1.67029 WP_000036723.1.67035 WP_000036723.1.67047 WP_000036723.1.67055 WP_000036723.1.6706 WP_000036723.1.67073 WP_000036723.1.67102 WP_000036723.1.67116 WP_000036723.1.67120 WP_000036723.1.67132 WP_000036723.1.67136 WP_000036723.1.67137 WP_000036723.1.67149 WP_000036723.1.67150 WP_000036723.1.67153 WP_000036723.1.67158 WP_000036723.1.67164 WP_000036723.1.67174 WP_000036723.1.67194 WP_000036723.1.67200 WP_000036723.1.67209 WP_000036723.1.67210 WP_000036723.1.67214 WP_000036723.1.6723 WP_000036723.1.67258 WP_000036723.1.67272 WP_000036723.1.67278 WP_000036723.1.67284 WP_000036723.1.67293 WP_000036723.1.6735 WP_000036723.1.67373 WP_000036723.1.67383 WP_000036723.1.67412 WP_000036723.1.67415 WP_000036723.1.67427 WP_000036723.1.67446 WP_000036723.1.67451 WP_000036723.1.67452 WP_000036723.1.67454 WP_000036723.1.67456 WP_000036723.1.67464 WP_000036723.1.67468 WP_000036723.1.67495 WP_000036723.1.67522 WP_000036723.1.67533 WP_000036723.1.67538 WP_000036723.1.67549 WP_000036723.1.67553 WP_000036723.1.67581 WP_000036723.1.67590 WP_000036723.1.67606 WP_000036723.1.67660 WP_000036723.1.67663 WP_000036723.1.67669 WP_000036723.1.67676 WP_000036723.1.67681 WP_000036723.1.67685 WP_000036723.1.6769 WP_000036723.1.67690 WP_000036723.1.67701 WP_000036723.1.67724 WP_000036723.1.67726 WP_000036723.1.67732 WP_000036723.1.67737 WP_000036723.1.67753 WP_000036723.1.67758 WP_000036723.1.67760 WP_000036723.1.67775 WP_000036723.1.67780 WP_000036723.1.67786 WP_000036723.1.67787 WP_000036723.1.67788 WP_000036723.1.678 WP_000036723.1.67810 WP_000036723.1.67841 WP_000036723.1.67853 WP_000036723.1.67861 WP_000036723.1.67891 WP_000036723.1.67894 WP_000036723.1.6793 WP_000036723.1.67971 WP_000036723.1.67975 WP_000036723.1.67990 WP_000036723.1.67992 WP_000036723.1.67999 WP_000036723.1.68008 WP_000036723.1.68011 WP_000036723.1.68012 WP_000036723.1.6802 WP_000036723.1.68025 WP_000036723.1.6803 WP_000036723.1.68039 WP_000036723.1.68052 WP_000036723.1.68058 WP_000036723.1.68059 WP_000036723.1.68063 WP_000036723.1.68067 WP_000036723.1.68069 WP_000036723.1.68070 WP_000036723.1.68071 WP_000036723.1.68079 WP_000036723.1.68096 WP_000036723.1.6810 WP_000036723.1.68138 WP_000036723.1.6814 WP_000036723.1.68157 WP_000036723.1.68170 WP_000036723.1.68175 WP_000036723.1.68177 WP_000036723.1.682 WP_000036723.1.68200 WP_000036723.1.68215 WP_000036723.1.68231 WP_000036723.1.68241 WP_000036723.1.68255 WP_000036723.1.68271 WP_000036723.1.68278 WP_000036723.1.68279 WP_000036723.1.68283 WP_000036723.1.68292 WP_000036723.1.68300 WP_000036723.1.68336 WP_000036723.1.68341 WP_000036723.1.68347 WP_000036723.1.68362 WP_000036723.1.68372 WP_000036723.1.68395 WP_000036723.1.68396 WP_000036723.1.68411 WP_000036723.1.68441 WP_000036723.1.68442 WP_000036723.1.68490 WP_000036723.1.68493 WP_000036723.1.68523 WP_000036723.1.68524 WP_000036723.1.68534 WP_000036723.1.68566 WP_000036723.1.68572 WP_000036723.1.6859 WP_000036723.1.6860 WP_000036723.1.68609 WP_000036723.1.68632 WP_000036723.1.68678 WP_000036723.1.68695 WP_000036723.1.68697 WP_000036723.1.68701 WP_000036723.1.68711 WP_000036723.1.68731 WP_000036723.1.68735 WP_000036723.1.68750 WP_000036723.1.68751 WP_000036723.1.6877 WP_000036723.1.68793 WP_000036723.1.68795 WP_000036723.1.68797 WP_000036723.1.6880 WP_000036723.1.68801 WP_000036723.1.68838 WP_000036723.1.68847 WP_000036723.1.68865 WP_000036723.1.6887 WP_000036723.1.68873 WP_000036723.1.68877 WP_000036723.1.68911 WP_000036723.1.68915 WP_000036723.1.6892 WP_000036723.1.68924 WP_000036723.1.68936 WP_000036723.1.68942 WP_000036723.1.68952 WP_000036723.1.68956 WP_000036723.1.6897 WP_000036723.1.68989 WP_000036723.1.68995 WP_000036723.1.69033 WP_000036723.1.69054 WP_000036723.1.69098 WP_000036723.1.69126 WP_000036723.1.69127 WP_000036723.1.69144 WP_000036723.1.69158 WP_000036723.1.6916 WP_000036723.1.69160 WP_000036723.1.6921 WP_000036723.1.69221 WP_000036723.1.6923 WP_000036723.1.69247 WP_000036723.1.69258 WP_000036723.1.69261 WP_000036723.1.69303 WP_000036723.1.69305 WP_000036723.1.69327 WP_000036723.1.69341 WP_000036723.1.69350 WP_000036723.1.69351 WP_000036723.1.69382 WP_000036723.1.69390 WP_000036723.1.694 WP_000036723.1.69404 WP_000036723.1.69438 WP_000036723.1.6945 WP_000036723.1.69450 WP_000036723.1.69472 WP_000036723.1.69473 WP_000036723.1.69502 WP_000036723.1.69506 WP_000036723.1.69551 WP_000036723.1.69569 WP_000036723.1.69583 WP_000036723.1.69589 WP_000036723.1.69593 WP_000036723.1.69596 WP_000036723.1.69605 WP_000036723.1.69643 WP_000036723.1.69646 WP_000036723.1.69649 WP_000036723.1.69655 WP_000036723.1.697 WP_000036723.1.69716 WP_000036723.1.69735 WP_000036723.1.69780 WP_000036723.1.69786 WP_000036723.1.69803 WP_000036723.1.69810 WP_000036723.1.69818 WP_000036723.1.69831 WP_000036723.1.69832 WP_000036723.1.69868 WP_000036723.1.69872 WP_000036723.1.69887 WP_000036723.1.69896 WP_000036723.1.6993 WP_000036723.1.69963 WP_000036723.1.69972 WP_000036723.1.69999 WP_000036723.1.7001 WP_000036723.1.70041 WP_000036723.1.70063 WP_000036723.1.701 WP_000036723.1.70123 WP_000036723.1.70125 WP_000036723.1.7013 WP_000036723.1.70149 WP_000036723.1.7015 WP_000036723.1.70190 WP_000036723.1.70191 WP_000036723.1.70200 WP_000036723.1.70213 WP_000036723.1.70230 WP_000036723.1.70251 WP_000036723.1.70264 WP_000036723.1.70299 WP_000036723.1.70300 WP_000036723.1.70337 WP_000036723.1.70341 WP_000036723.1.70357 WP_000036723.1.70370 WP_000036723.1.70386 WP_000036723.1.70407 WP_000036723.1.70408 WP_000036723.1.70414 WP_000036723.1.70477 WP_000036723.1.70492 WP_000036723.1.7050 WP_000036723.1.70517 WP_000036723.1.7052 WP_000036723.1.70539 WP_000036723.1.70563 WP_000036723.1.70576 WP_000036723.1.70578 WP_000036723.1.70582 WP_000036723.1.70592 WP_000036723.1.70597 WP_000036723.1.70619 WP_000036723.1.70628 WP_000036723.1.70655 WP_000036723.1.70686 WP_000036723.1.70694 WP_000036723.1.70698 WP_000036723.1.70705 WP_000036723.1.70713 WP_000036723.1.70723 WP_000036723.1.70745 WP_000036723.1.70748 WP_000036723.1.70767 WP_000036723.1.70787 WP_000036723.1.70794 WP_000036723.1.70801 WP_000036723.1.70803 WP_000036723.1.70880 WP_000036723.1.70896 WP_000036723.1.7090 WP_000036723.1.70900 WP_000036723.1.70952 WP_000036723.1.70967 WP_000036723.1.71003 WP_000036723.1.7102 WP_000036723.1.71024 WP_000036723.1.71062 WP_000036723.1.71099 WP_000036723.1.71109 WP_000036723.1.71113 WP_000036723.1.71134 WP_000036723.1.71139 WP_000036723.1.71144 WP_000036723.1.71147 WP_000036723.1.71149 WP_000036723.1.71158 WP_000036723.1.71159 WP_000036723.1.71162 WP_000036723.1.71176 WP_000036723.1.71183 WP_000036723.1.71192 WP_000036723.1.71199 WP_000036723.1.71205 WP_000036723.1.7121 WP_000036723.1.71221 WP_000036723.1.71225 WP_000036723.1.71226 WP_000036723.1.71229 WP_000036723.1.71269 WP_000036723.1.71272 WP_000036723.1.71275 WP_000036723.1.71285 WP_000036723.1.71287 WP_000036723.1.71294 WP_000036723.1.71311 WP_000036723.1.71312 WP_000036723.1.71315 WP_000036723.1.71323 WP_000036723.1.71327 WP_000036723.1.71339 WP_000036723.1.71354 WP_000036723.1.71397 WP_000036723.1.71403 WP_000036723.1.71405 WP_000036723.1.71409 WP_000036723.1.71421 WP_000036723.1.71423 WP_000036723.1.71448 WP_000036723.1.71480 WP_000036723.1.71522 WP_000036723.1.71533 WP_000036723.1.71537 WP_000036723.1.71538 WP_000036723.1.71540 WP_000036723.1.71562 WP_000036723.1.71563 WP_000036723.1.71603 WP_000036723.1.71607 WP_000036723.1.71632 WP_000036723.1.71680 WP_000036723.1.71690 WP_000036723.1.71695 WP_000036723.1.71712 WP_000036723.1.71724 WP_000036723.1.71732 WP_000036723.1.71757 WP_000036723.1.71767 WP_000036723.1.71783 WP_000036723.1.71830 WP_000036723.1.71837 WP_000036723.1.71840 WP_000036723.1.71855 WP_000036723.1.71856 WP_000036723.1.71874 WP_000036723.1.71912 WP_000036723.1.7192 WP_000036723.1.71939 WP_000036723.1.71940 WP_000036723.1.71944 WP_000036723.1.71967 WP_000036723.1.71972 WP_000036723.1.71975 WP_000036723.1.71987 WP_000036723.1.71993 WP_000036723.1.71995 WP_000036723.1.72013 WP_000036723.1.72016 WP_000036723.1.72021 WP_000036723.1.72028 WP_000036723.1.72033 WP_000036723.1.72048 WP_000036723.1.7205 WP_000036723.1.72053 WP_000036723.1.72066 WP_000036723.1.72090 WP_000036723.1.72098 WP_000036723.1.7210 WP_000036723.1.72117 WP_000036723.1.72125 WP_000036723.1.72141 WP_000036723.1.72153 WP_000036723.1.72155 WP_000036723.1.72157 WP_000036723.1.72161 WP_000036723.1.72162 WP_000036723.1.72180 WP_000036723.1.72184 WP_000036723.1.72186 WP_000036723.1.72208 WP_000036723.1.72212 WP_000036723.1.72237 WP_000036723.1.72240 WP_000036723.1.72248 WP_000036723.1.7225 WP_000036723.1.72258 WP_000036723.1.72261 WP_000036723.1.72270 WP_000036723.1.72279 WP_000036723.1.72290 WP_000036723.1.72298 WP_000036723.1.723 WP_000036723.1.72316 WP_000036723.1.72322 WP_000036723.1.72337 WP_000036723.1.72342 WP_000036723.1.72352 WP_000036723.1.72359 WP_000036723.1.72388 WP_000036723.1.72397 WP_000036723.1.72425 WP_000036723.1.72427 WP_000036723.1.72431 WP_000036723.1.72436 WP_000036723.1.72449 WP_000036723.1.72469 WP_000036723.1.72485 WP_000036723.1.72493 WP_000036723.1.72507 WP_000036723.1.72511 WP_000036723.1.72521 WP_000036723.1.72535 WP_000036723.1.72537 WP_000036723.1.72544 WP_000036723.1.72551 WP_000036723.1.72582 WP_000036723.1.72588 WP_000036723.1.72596 WP_000036723.1.72599 WP_000036723.1.72606 WP_000036723.1.72608 WP_000036723.1.72614 WP_000036723.1.72615 WP_000036723.1.72616 WP_000036723.1.72619 WP_000036723.1.72641 WP_000036723.1.72643 WP_000036723.1.72652 WP_000036723.1.72663 WP_000036723.1.72694 WP_000036723.1.72695 WP_000036723.1.72698 WP_000036723.1.72700 WP_000036723.1.72706 WP_000036723.1.72725 WP_000036723.1.72729 WP_000036723.1.72745 WP_000036723.1.72747 WP_000036723.1.72748 WP_000036723.1.72751 WP_000036723.1.72758 WP_000036723.1.72764 WP_000036723.1.7277 WP_000036723.1.72778 WP_000036723.1.72806 WP_000036723.1.7281 WP_000036723.1.72857 WP_000036723.1.72858 WP_000036723.1.72860 WP_000036723.1.72869 WP_000036723.1.72893 WP_000036723.1.7291 WP_000036723.1.72910 WP_000036723.1.72913 WP_000036723.1.72947 WP_000036723.1.72950 WP_000036723.1.72956 WP_000036723.1.72962 WP_000036723.1.73000 WP_000036723.1.73010 WP_000036723.1.73032 WP_000036723.1.73039 WP_000036723.1.73061 WP_000036723.1.7307 WP_000036723.1.73072 WP_000036723.1.73075 WP_000036723.1.73085 WP_000036723.1.7309 WP_000036723.1.73094 WP_000036723.1.73126 WP_000036723.1.73129 WP_000036723.1.73197 WP_000036723.1.73215 WP_000036723.1.73217 WP_000036723.1.73230 WP_000036723.1.73239 WP_000036723.1.73243 WP_000036723.1.73249 WP_000036723.1.73251 WP_000036723.1.73257 WP_000036723.1.73259 WP_000036723.1.73277 WP_000036723.1.73283 WP_000036723.1.73291 WP_000036723.1.73292 WP_000036723.1.73295 WP_000036723.1.73326 WP_000036723.1.73333 WP_000036723.1.73340 WP_000036723.1.73343 WP_000036723.1.73344 WP_000036723.1.73349 WP_000036723.1.73385 WP_000036723.1.73428 WP_000036723.1.7345 WP_000036723.1.73468 WP_000036723.1.73486 WP_000036723.1.7349 WP_000036723.1.73524 WP_000036723.1.73565 WP_000036723.1.73572 WP_000036723.1.73604 WP_000036723.1.73626 WP_000036723.1.73663 WP_000036723.1.73700 WP_000036723.1.73709 WP_000036723.1.73717 WP_000036723.1.73743 WP_000036723.1.73748 WP_000036723.1.7376 WP_000036723.1.73783 WP_000036723.1.73785 WP_000036723.1.73797 WP_000036723.1.73801 WP_000036723.1.73807 WP_000036723.1.73811 WP_000036723.1.73827 WP_000036723.1.73835 WP_000036723.1.73843 WP_000036723.1.73844 WP_000036723.1.73846 WP_000036723.1.73859 WP_000036723.1.73882 WP_000036723.1.73897 WP_000036723.1.73908 WP_000036723.1.7392 WP_000036723.1.73934 WP_000036723.1.73942 WP_000036723.1.73968 WP_000036723.1.73992 WP_000036723.1.73995 WP_000036723.1.73996 WP_000036723.1.74032 WP_000036723.1.74041 WP_000036723.1.74045 WP_000036723.1.74046 WP_000036723.1.74051 WP_000036723.1.7407 WP_000036723.1.74123 WP_000036723.1.7413 WP_000036723.1.74156 WP_000036723.1.74184 WP_000036723.1.74185 WP_000036723.1.7424 WP_000036723.1.74243 WP_000036723.1.74251 WP_000036723.1.74267 WP_000036723.1.7429 WP_000036723.1.74309 WP_000036723.1.74358 WP_000036723.1.74365 WP_000036723.1.74367 WP_000036723.1.744 WP_000036723.1.74423 WP_000036723.1.74426 WP_000036723.1.74431 WP_000036723.1.74444 WP_000036723.1.74445 WP_000036723.1.7446 WP_000036723.1.74478 WP_000036723.1.74491 WP_000036723.1.74501 WP_000036723.1.74509 WP_000036723.1.74513 WP_000036723.1.74520 WP_000036723.1.74521 WP_000036723.1.74528 WP_000036723.1.74532 WP_000036723.1.74536 WP_000036723.1.74549 WP_000036723.1.74557 WP_000036723.1.74574 WP_000036723.1.7461 WP_000036723.1.74611 WP_000036723.1.74623 WP_000036723.1.74624 WP_000036723.1.74625 WP_000036723.1.74631 WP_000036723.1.74652 WP_000036723.1.74670 WP_000036723.1.74682 WP_000036723.1.74687 WP_000036723.1.74688 WP_000036723.1.74689 WP_000036723.1.74691 WP_000036723.1.74705 WP_000036723.1.74713 WP_000036723.1.74720 WP_000036723.1.74735 WP_000036723.1.7475 WP_000036723.1.74752 WP_000036723.1.74765 WP_000036723.1.74767 WP_000036723.1.7478 WP_000036723.1.7479 WP_000036723.1.74793 WP_000036723.1.74811 WP_000036723.1.74828 WP_000036723.1.74844 WP_000036723.1.74852 WP_000036723.1.74854 WP_000036723.1.74860 WP_000036723.1.74880 WP_000036723.1.74885 WP_000036723.1.74889 WP_000036723.1.74904 WP_000036723.1.74915 WP_000036723.1.74962 WP_000036723.1.74993 WP_000036723.1.74998 WP_000036723.1.75021 WP_000036723.1.75029 WP_000036723.1.75030 WP_000036723.1.75050 WP_000036723.1.75087 WP_000036723.1.75100 WP_000036723.1.75118 WP_000036723.1.75124 WP_000036723.1.75136 WP_000036723.1.75139 WP_000036723.1.75145 WP_000036723.1.75149 WP_000036723.1.75155 WP_000036723.1.7516 WP_000036723.1.75164 WP_000036723.1.75181 WP_000036723.1.75209 WP_000036723.1.75218 WP_000036723.1.75228 WP_000036723.1.75243 WP_000036723.1.75248 WP_000036723.1.75254 WP_000036723.1.75270 WP_000036723.1.75272 WP_000036723.1.75306 WP_000036723.1.7536 WP_000036723.1.75360 WP_000036723.1.75367 WP_000036723.1.75382 WP_000036723.1.7539 WP_000036723.1.75419 WP_000036723.1.75428 WP_000036723.1.75435 WP_000036723.1.75465 WP_000036723.1.75491 WP_000036723.1.75505 WP_000036723.1.75507 WP_000036723.1.75515 WP_000036723.1.75529 WP_000036723.1.75536 WP_000036723.1.75537 WP_000036723.1.75557 WP_000036723.1.75577 WP_000036723.1.75588 WP_000036723.1.75594 WP_000036723.1.75612 WP_000036723.1.75629 WP_000036723.1.75644 WP_000036723.1.75653 WP_000036723.1.75672 WP_000036723.1.75676 WP_000036723.1.75679 WP_000036723.1.75687 WP_000036723.1.75694 WP_000036723.1.75696 WP_000036723.1.75699 WP_000036723.1.75725 WP_000036723.1.75735 WP_000036723.1.75758 WP_000036723.1.75767 WP_000036723.1.75786 WP_000036723.1.75808 WP_000036723.1.7583 WP_000036723.1.75839 WP_000036723.1.75853 WP_000036723.1.75892 WP_000036723.1.75918 WP_000036723.1.75922 WP_000036723.1.7597 WP_000036723.1.75973 WP_000036723.1.75983 WP_000036723.1.75989 WP_000036723.1.75995 WP_000036723.1.75999 WP_000036723.1.76009 WP_000036723.1.76019 WP_000036723.1.7603 WP_000036723.1.76030 WP_000036723.1.76036 WP_000036723.1.76039 WP_000036723.1.76054 WP_000036723.1.76057 WP_000036723.1.7608 WP_000036723.1.76087 WP_000036723.1.76103 WP_000036723.1.76119 WP_000036723.1.76129 WP_000036723.1.7613 WP_000036723.1.76152 WP_000036723.1.7617 WP_000036723.1.76184 WP_000036723.1.76189 WP_000036723.1.76194 WP_000036723.1.76196 WP_000036723.1.76211 WP_000036723.1.76237 WP_000036723.1.76268 WP_000036723.1.76269 WP_000036723.1.76305 WP_000036723.1.76312 WP_000036723.1.76325 WP_000036723.1.76335 WP_000036723.1.76361 WP_000036723.1.76376 WP_000036723.1.76384 WP_000036723.1.76387 WP_000036723.1.76390 WP_000036723.1.76407 WP_000036723.1.76446 WP_000036723.1.76447 WP_000036723.1.76448 WP_000036723.1.76452 WP_000036723.1.76460 WP_000036723.1.76462 WP_000036723.1.76469 WP_000036723.1.76477 WP_000036723.1.76504 WP_000036723.1.76542 WP_000036723.1.76547 WP_000036723.1.76562 WP_000036723.1.76595 WP_000036723.1.76596 WP_000036723.1.7661 WP_000036723.1.76619 WP_000036723.1.76643 WP_000036723.1.76656 WP_000036723.1.76660 WP_000036723.1.76697 WP_000036723.1.76701 WP_000036723.1.76707 WP_000036723.1.76712 WP_000036723.1.76751 WP_000036723.1.76759 WP_000036723.1.7680 WP_000036723.1.76815 WP_000036723.1.76827 WP_000036723.1.76831 WP_000036723.1.76840 WP_000036723.1.76863 WP_000036723.1.7689 WP_000036723.1.76909 WP_000036723.1.76918 WP_000036723.1.76933 WP_000036723.1.76948 WP_000036723.1.76957 WP_000036723.1.76961 WP_000036723.1.76965 WP_000036723.1.76966 WP_000036723.1.7699 WP_000036723.1.76994 WP_000036723.1.77007 WP_000036723.1.77015 WP_000036723.1.77022 WP_000036723.1.77036 WP_000036723.1.77042 WP_000036723.1.77057 WP_000036723.1.77070 WP_000036723.1.77081 WP_000036723.1.77099 WP_000036723.1.771 WP_000036723.1.77109 WP_000036723.1.77128 WP_000036723.1.77134 WP_000036723.1.77147 WP_000036723.1.77162 WP_000036723.1.77163 WP_000036723.1.77173 WP_000036723.1.77175 WP_000036723.1.77198 WP_000036723.1.77200 WP_000036723.1.77204 WP_000036723.1.77214 WP_000036723.1.77224 WP_000036723.1.77239 WP_000036723.1.77253 WP_000036723.1.77255 WP_000036723.1.77258 WP_000036723.1.77275 WP_000036723.1.7728 WP_000036723.1.77284 WP_000036723.1.7729 WP_000036723.1.77290 WP_000036723.1.77291 WP_000036723.1.77296 WP_000036723.1.7731 WP_000036723.1.77320 WP_000036723.1.77326 WP_000036723.1.77341 WP_000036723.1.77358 WP_000036723.1.77392 WP_000036723.1.77408 WP_000036723.1.77419 WP_000036723.1.77432 WP_000036723.1.77437 WP_000036723.1.77452 WP_000036723.1.77455 WP_000036723.1.77462 WP_000036723.1.7747 WP_000036723.1.77470 WP_000036723.1.77471 WP_000036723.1.77477 WP_000036723.1.77481 WP_000036723.1.77487 WP_000036723.1.77495 WP_000036723.1.775 WP_000036723.1.7750 WP_000036723.1.77503 WP_000036723.1.77511 WP_000036723.1.77542 WP_000036723.1.77551 WP_000036723.1.77577 WP_000036723.1.77581 WP_000036723.1.77595 WP_000036723.1.77608 WP_000036723.1.77626 WP_000036723.1.77632 WP_000036723.1.77636 WP_000036723.1.77643 WP_000036723.1.77644 WP_000036723.1.77648 WP_000036723.1.77657 WP_000036723.1.77707 WP_000036723.1.77741 WP_000036723.1.7775 WP_000036723.1.77760 WP_000036723.1.77767 WP_000036723.1.77768 WP_000036723.1.7780 WP_000036723.1.7781 WP_000036723.1.77813 WP_000036723.1.77816 WP_000036723.1.77826 WP_000036723.1.77833 WP_000036723.1.77876 WP_000036723.1.77929 WP_000036723.1.77949 WP_000036723.1.77950 WP_000036723.1.77961 WP_000036723.1.77979 WP_000036723.1.7799 WP_000036723.1.77999 WP_000036723.1.78000 WP_000036723.1.78007 WP_000036723.1.78010 WP_000036723.1.7804 WP_000036723.1.78041 WP_000036723.1.78063 WP_000036723.1.7808 WP_000036723.1.78089 WP_000036723.1.78097 WP_000036723.1.78099 WP_000036723.1.78101 WP_000036723.1.78102 WP_000036723.1.78131 WP_000036723.1.78183 WP_000036723.1.78187 WP_000036723.1.78188 WP_000036723.1.78196 WP_000036723.1.78202 WP_000036723.1.78232 WP_000036723.1.78233 WP_000036723.1.78235 WP_000036723.1.78297 WP_000036723.1.78305 WP_000036723.1.78321 WP_000036723.1.78323 WP_000036723.1.78337 WP_000036723.1.78368 WP_000036723.1.78376 WP_000036723.1.78377 WP_000036723.1.784 WP_000036723.1.78413 WP_000036723.1.78445 WP_000036723.1.78453 WP_000036723.1.78462 WP_000036723.1.78463 WP_000036723.1.7847 WP_000036723.1.78477 WP_000036723.1.78481 WP_000036723.1.78491 WP_000036723.1.78512 WP_000036723.1.78515 WP_000036723.1.78523 WP_000036723.1.7855 WP_000036723.1.78572 WP_000036723.1.78575 WP_000036723.1.78581 WP_000036723.1.78583 WP_000036723.1.78586 WP_000036723.1.78593 WP_000036723.1.78610 WP_000036723.1.78611 WP_000036723.1.78612 WP_000036723.1.78615 WP_000036723.1.78622 WP_000036723.1.78645 WP_000036723.1.78677 WP_000036723.1.78683 WP_000036723.1.78687 WP_000036723.1.78689 WP_000036723.1.78698 WP_000036723.1.78706 WP_000036723.1.78714 WP_000036723.1.78718 WP_000036723.1.78750 WP_000036723.1.78757 WP_000036723.1.78773 WP_000036723.1.78775 WP_000036723.1.78791 WP_000036723.1.78814 WP_000036723.1.7883 WP_000036723.1.78843 WP_000036723.1.78845 WP_000036723.1.78854 WP_000036723.1.78888 WP_000036723.1.78891 WP_000036723.1.78893 WP_000036723.1.78908 WP_000036723.1.78919 WP_000036723.1.78953 WP_000036723.1.78955 WP_000036723.1.78956 WP_000036723.1.7896 WP_000036723.1.78966 WP_000036723.1.7898 WP_000036723.1.78996 WP_000036723.1.79001 WP_000036723.1.79004 WP_000036723.1.7901 WP_000036723.1.79065 WP_000036723.1.79067 WP_000036723.1.79075 WP_000036723.1.79086 WP_000036723.1.79092 WP_000036723.1.79100 WP_000036723.1.79126 WP_000036723.1.79137 WP_000036723.1.79159 WP_000036723.1.79172 WP_000036723.1.79233 WP_000036723.1.79243 WP_000036723.1.79246 WP_000036723.1.79248 WP_000036723.1.79249 WP_000036723.1.79276 WP_000036723.1.79306 WP_000036723.1.79312 WP_000036723.1.79342 WP_000036723.1.79343 WP_000036723.1.79346 WP_000036723.1.79348 WP_000036723.1.79356 WP_000036723.1.79365 WP_000036723.1.79368 WP_000036723.1.79369 WP_000036723.1.7937 WP_000036723.1.79389 WP_000036723.1.79391 WP_000036723.1.7940 WP_000036723.1.79409 WP_000036723.1.79414 WP_000036723.1.79464 WP_000036723.1.79478 WP_000036723.1.79505 WP_000036723.1.79519 WP_000036723.1.7952 WP_000036723.1.79525 WP_000036723.1.79526 WP_000036723.1.79528 WP_000036723.1.79540 WP_000036723.1.79558 WP_000036723.1.79563 WP_000036723.1.79576 WP_000036723.1.79591 WP_000036723.1.79606 WP_000036723.1.79619 WP_000036723.1.79640 WP_000036723.1.7967 WP_000036723.1.79685 WP_000036723.1.79707 WP_000036723.1.79713 WP_000036723.1.79715 WP_000036723.1.79749 WP_000036723.1.79759 WP_000036723.1.79764 WP_000036723.1.79800 WP_000036723.1.79816 WP_000036723.1.79824 WP_000036723.1.79840 WP_000036723.1.7985 WP_000036723.1.79866 WP_000036723.1.79869 WP_000036723.1.7987 WP_000036723.1.79871 WP_000036723.1.79877 WP_000036723.1.79905 WP_000036723.1.79922 WP_000036723.1.7993 WP_000036723.1.79930 WP_000036723.1.79931 WP_000036723.1.79932 WP_000036723.1.79933 WP_000036723.1.79936 WP_000036723.1.79944 WP_000036723.1.79952 WP_000036723.1.79955 WP_000036723.1.79965 WP_000036723.1.79973 WP_000036723.1.79984 WP_000036723.1.79995 WP_000036723.1.80 WP_000036723.1.80016 WP_000036723.1.80026 WP_000036723.1.8004 WP_000036723.1.80043 WP_000036723.1.80050 WP_000036723.1.80060 WP_000036723.1.80061 WP_000036723.1.80063 WP_000036723.1.8007 WP_000036723.1.80071 WP_000036723.1.80096 WP_000036723.1.8011 WP_000036723.1.80112 WP_000036723.1.80136 WP_000036723.1.80141 WP_000036723.1.80168 WP_000036723.1.80179 WP_000036723.1.80183 WP_000036723.1.80255 WP_000036723.1.80292 WP_000036723.1.80309 WP_000036723.1.80310 WP_000036723.1.80320 WP_000036723.1.80330 WP_000036723.1.80343 WP_000036723.1.80392 WP_000036723.1.804 WP_000036723.1.80402 WP_000036723.1.80426 WP_000036723.1.80428 WP_000036723.1.80440 WP_000036723.1.80444 WP_000036723.1.80463 WP_000036723.1.80484 WP_000036723.1.80517 WP_000036723.1.80519 WP_000036723.1.80558 WP_000036723.1.80559 WP_000036723.1.8057 WP_000036723.1.80577 WP_000036723.1.80578 WP_000036723.1.80606 WP_000036723.1.80612 WP_000036723.1.80626 WP_000036723.1.80660 WP_000036723.1.80662 WP_000036723.1.80666 WP_000036723.1.8068 WP_000036723.1.80709 WP_000036723.1.80718 WP_000036723.1.80724 WP_000036723.1.80736 WP_000036723.1.80737 WP_000036723.1.80753 WP_000036723.1.80754 WP_000036723.1.80756 WP_000036723.1.8076 WP_000036723.1.80768 WP_000036723.1.80789 WP_000036723.1.80804 WP_000036723.1.80805 WP_000036723.1.80843 WP_000036723.1.80862 WP_000036723.1.80884 WP_000036723.1.80894 WP_000036723.1.8090 WP_000036723.1.80935 WP_000036723.1.80945 WP_000036723.1.80946 WP_000036723.1.80948 WP_000036723.1.80966 WP_000036723.1.80983 WP_000036723.1.80985 WP_000036723.1.810 WP_000036723.1.81026 WP_000036723.1.81032 WP_000036723.1.81034 WP_000036723.1.81036 WP_000036723.1.81054 WP_000036723.1.81056 WP_000036723.1.81070 WP_000036723.1.81098 WP_000036723.1.811 WP_000036723.1.81104 WP_000036723.1.81120 WP_000036723.1.81127 WP_000036723.1.81141 WP_000036723.1.81156 WP_000036723.1.81160 WP_000036723.1.81165 WP_000036723.1.8118 WP_000036723.1.81182 WP_000036723.1.81186 WP_000036723.1.8121 WP_000036723.1.81219 WP_000036723.1.81266 WP_000036723.1.81267 WP_000036723.1.81273 WP_000036723.1.81283 WP_000036723.1.8129 WP_000036723.1.81313 WP_000036723.1.81316 WP_000036723.1.81323 WP_000036723.1.81347 WP_000036723.1.81376 WP_000036723.1.81391 WP_000036723.1.81396 WP_000036723.1.814 WP_000036723.1.81418 WP_000036723.1.81420 WP_000036723.1.81423 WP_000036723.1.81438 WP_000036723.1.81442 WP_000036723.1.81469 WP_000036723.1.81475 WP_000036723.1.81484 WP_000036723.1.81514 WP_000036723.1.81517 WP_000036723.1.81576 WP_000036723.1.81577 WP_000036723.1.81580 WP_000036723.1.81582 WP_000036723.1.81588 WP_000036723.1.81589 WP_000036723.1.81596 WP_000036723.1.81618 WP_000036723.1.81624 WP_000036723.1.81625 WP_000036723.1.81688 WP_000036723.1.81715 WP_000036723.1.8172 WP_000036723.1.81723 WP_000036723.1.81739 WP_000036723.1.81754 WP_000036723.1.81761 WP_000036723.1.81806 WP_000036723.1.81819 WP_000036723.1.81821 WP_000036723.1.8183 WP_000036723.1.81832 WP_000036723.1.81843 WP_000036723.1.81869 WP_000036723.1.81873 WP_000036723.1.81876 WP_000036723.1.81888 WP_000036723.1.81914 WP_000036723.1.81934 WP_000036723.1.81935 WP_000036723.1.81939 WP_000036723.1.81956 WP_000036723.1.81972 WP_000036723.1.81975 WP_000036723.1.82 WP_000036723.1.82008 WP_000036723.1.82010 WP_000036723.1.82057 WP_000036723.1.82059 WP_000036723.1.82062 WP_000036723.1.82074 WP_000036723.1.82104 WP_000036723.1.82106 WP_000036723.1.82123 WP_000036723.1.82137 WP_000036723.1.82166 WP_000036723.1.82217 WP_000036723.1.82221 WP_000036723.1.82239 WP_000036723.1.82240 WP_000036723.1.82242 WP_000036723.1.82246 WP_000036723.1.82275 WP_000036723.1.82296 WP_000036723.1.82316 WP_000036723.1.82326 WP_000036723.1.8235 WP_000036723.1.82378 WP_000036723.1.82439 WP_000036723.1.82485 WP_000036723.1.82499 WP_000036723.1.82507 WP_000036723.1.82514 WP_000036723.1.82527 WP_000036723.1.82536 WP_000036723.1.82539 WP_000036723.1.8255 WP_000036723.1.82572 WP_000036723.1.82589 WP_000036723.1.82594 WP_000036723.1.82626 WP_000036723.1.82629 WP_000036723.1.82647 WP_000036723.1.82661 WP_000036723.1.8268 WP_000036723.1.82682 WP_000036723.1.82691 WP_000036723.1.82698 WP_000036723.1.82700 WP_000036723.1.82711 WP_000036723.1.82715 WP_000036723.1.82718 WP_000036723.1.82747 WP_000036723.1.82754 WP_000036723.1.8277 WP_000036723.1.82776 WP_000036723.1.82780 WP_000036723.1.82784 WP_000036723.1.82797 WP_000036723.1.82799 WP_000036723.1.82808 WP_000036723.1.82816 WP_000036723.1.82820 WP_000036723.1.82831 WP_000036723.1.82833 WP_000036723.1.82853 WP_000036723.1.82901 WP_000036723.1.82923 WP_000036723.1.8295 WP_000036723.1.82991 WP_000036723.1.83020 WP_000036723.1.83035 WP_000036723.1.83036 WP_000036723.1.83051 WP_000036723.1.83059 WP_000036723.1.8306 WP_000036723.1.8308 WP_000036723.1.83093 WP_000036723.1.83097 WP_000036723.1.83099 WP_000036723.1.831 WP_000036723.1.83118 WP_000036723.1.83125 WP_000036723.1.83127 WP_000036723.1.83144 WP_000036723.1.83151 WP_000036723.1.83205 WP_000036723.1.83214 WP_000036723.1.83218 WP_000036723.1.83224 WP_000036723.1.83238 WP_000036723.1.83253 WP_000036723.1.83256 WP_000036723.1.83286 WP_000036723.1.83313 WP_000036723.1.83321 WP_000036723.1.83340 WP_000036723.1.83347 WP_000036723.1.83375 WP_000036723.1.83384 WP_000036723.1.83393 WP_000036723.1.83415 WP_000036723.1.8345 WP_000036723.1.83481 WP_000036723.1.83506 WP_000036723.1.83537 WP_000036723.1.83544 WP_000036723.1.83564 WP_000036723.1.83582 WP_000036723.1.83584 WP_000036723.1.83644 WP_000036723.1.83660 WP_000036723.1.83668 WP_000036723.1.8368 WP_000036723.1.83684 WP_000036723.1.83706 WP_000036723.1.83712 WP_000036723.1.83735 WP_000036723.1.83762 WP_000036723.1.83781 WP_000036723.1.83807 WP_000036723.1.83820 WP_000036723.1.8384 WP_000036723.1.8386 WP_000036723.1.83879 WP_000036723.1.83911 WP_000036723.1.83936 WP_000036723.1.83941 WP_000036723.1.84004 WP_000036723.1.84014 WP_000036723.1.84021 WP_000036723.1.8405 WP_000036723.1.84059 WP_000036723.1.84060 WP_000036723.1.8408 WP_000036723.1.8411 WP_000036723.1.84140 WP_000036723.1.84164 WP_000036723.1.84172 WP_000036723.1.84185 WP_000036723.1.84197 WP_000036723.1.84210 WP_000036723.1.84215 WP_000036723.1.84219 WP_000036723.1.84221 WP_000036723.1.84264 WP_000036723.1.84298 WP_000036723.1.84312 WP_000036723.1.84313 WP_000036723.1.84316 WP_000036723.1.84319 WP_000036723.1.84326 WP_000036723.1.84331 WP_000036723.1.84339 WP_000036723.1.84348 WP_000036723.1.84402 WP_000036723.1.84405 WP_000036723.1.84410 WP_000036723.1.84436 WP_000036723.1.8444 WP_000036723.1.84464 WP_000036723.1.84467 WP_000036723.1.8447 WP_000036723.1.84473 WP_000036723.1.84476 WP_000036723.1.84482 WP_000036723.1.84484 WP_000036723.1.84486 WP_000036723.1.84511 WP_000036723.1.84518 WP_000036723.1.84531 WP_000036723.1.84534 WP_000036723.1.84584 WP_000036723.1.84635 WP_000036723.1.84639 WP_000036723.1.84656 WP_000036723.1.84657 WP_000036723.1.84668 WP_000036723.1.84675 WP_000036723.1.84697 WP_000036723.1.8470 WP_000036723.1.84731 WP_000036723.1.84738 WP_000036723.1.84740 WP_000036723.1.8477 WP_000036723.1.84797 WP_000036723.1.84841 WP_000036723.1.84850 WP_000036723.1.84875 WP_000036723.1.84878 WP_000036723.1.84881 WP_000036723.1.84893 WP_000036723.1.84894 WP_000036723.1.84916 WP_000036723.1.84929 WP_000036723.1.84941 WP_000036723.1.84948 WP_000036723.1.84966 WP_000036723.1.84972 WP_000036723.1.84977 WP_000036723.1.84986 WP_000036723.1.84989 WP_000036723.1.84990 WP_000036723.1.84994 WP_000036723.1.85002 WP_000036723.1.85008 WP_000036723.1.85011 WP_000036723.1.85025 WP_000036723.1.85048 WP_000036723.1.85052 WP_000036723.1.85077 WP_000036723.1.85085 WP_000036723.1.85090 WP_000036723.1.85098 WP_000036723.1.85105 WP_000036723.1.85106 WP_000036723.1.85112 WP_000036723.1.85125 WP_000036723.1.85129 WP_000036723.1.85138 WP_000036723.1.85155 WP_000036723.1.8517 WP_000036723.1.85188 WP_000036723.1.85216 WP_000036723.1.85241 WP_000036723.1.85247 WP_000036723.1.85252 WP_000036723.1.85253 WP_000036723.1.85255 WP_000036723.1.85260 WP_000036723.1.85310 WP_000036723.1.85315 WP_000036723.1.85320 WP_000036723.1.85323 WP_000036723.1.85329 WP_000036723.1.85335 WP_000036723.1.85336 WP_000036723.1.85342 WP_000036723.1.85361 WP_000036723.1.85384 WP_000036723.1.85416 WP_000036723.1.85435 WP_000036723.1.85504 WP_000036723.1.85525 WP_000036723.1.85546 WP_000036723.1.85554 WP_000036723.1.85556 WP_000036723.1.85558 WP_000036723.1.85563 WP_000036723.1.85578 WP_000036723.1.85593 WP_000036723.1.8560 WP_000036723.1.85601 WP_000036723.1.85621 WP_000036723.1.85623 WP_000036723.1.8564 WP_000036723.1.85657 WP_000036723.1.85722 WP_000036723.1.85752 WP_000036723.1.85762 WP_000036723.1.85772 WP_000036723.1.85773 WP_000036723.1.85781 WP_000036723.1.8579 WP_000036723.1.85806 WP_000036723.1.8582 WP_000036723.1.85857 WP_000036723.1.8592 WP_000036723.1.85939 WP_000036723.1.85944 WP_000036723.1.85948 WP_000036723.1.85969 WP_000036723.1.86001 WP_000036723.1.86016 WP_000036723.1.8603 WP_000036723.1.86035 WP_000036723.1.8607 WP_000036723.1.86104 WP_000036723.1.86105 WP_000036723.1.86110 WP_000036723.1.86145 WP_000036723.1.86149 WP_000036723.1.86161 WP_000036723.1.86166 WP_000036723.1.86171 WP_000036723.1.86176 WP_000036723.1.86179 WP_000036723.1.86189 WP_000036723.1.86196 WP_000036723.1.8621 WP_000036723.1.86210 WP_000036723.1.86225 WP_000036723.1.86227 WP_000036723.1.86228 WP_000036723.1.86234 WP_000036723.1.86255 WP_000036723.1.86261 WP_000036723.1.86263 WP_000036723.1.86266 WP_000036723.1.86273 WP_000036723.1.86276 WP_000036723.1.86280 WP_000036723.1.86283 WP_000036723.1.86294 WP_000036723.1.86307 WP_000036723.1.86340 WP_000036723.1.8635 WP_000036723.1.86353 WP_000036723.1.86355 WP_000036723.1.86364 WP_000036723.1.86371 WP_000036723.1.86376 WP_000036723.1.86393 WP_000036723.1.86411 WP_000036723.1.86412 WP_000036723.1.86437 WP_000036723.1.86451 WP_000036723.1.86452 WP_000036723.1.86454 WP_000036723.1.86461 WP_000036723.1.86475 WP_000036723.1.86483 WP_000036723.1.86492 WP_000036723.1.8652 WP_000036723.1.8656 WP_000036723.1.86560 WP_000036723.1.86574 WP_000036723.1.86583 WP_000036723.1.86586 WP_000036723.1.86598 WP_000036723.1.86609 WP_000036723.1.86613 WP_000036723.1.86617 WP_000036723.1.86627 WP_000036723.1.86640 WP_000036723.1.86667 WP_000036723.1.86673 WP_000036723.1.86674 WP_000036723.1.86681 WP_000036723.1.86691 WP_000036723.1.86707 WP_000036723.1.86717 WP_000036723.1.86727 WP_000036723.1.86731 WP_000036723.1.86753 WP_000036723.1.86760 WP_000036723.1.86768 WP_000036723.1.86787 WP_000036723.1.86788 WP_000036723.1.8679 WP_000036723.1.86833 WP_000036723.1.86848 WP_000036723.1.8687 WP_000036723.1.86934 WP_000036723.1.86935 WP_000036723.1.86956 WP_000036723.1.86959 WP_000036723.1.86975 WP_000036723.1.86994 WP_000036723.1.86997 WP_000036723.1.87043 WP_000036723.1.8705 WP_000036723.1.87067 WP_000036723.1.87074 WP_000036723.1.87075 WP_000036723.1.87076 WP_000036723.1.87102 WP_000036723.1.87109 WP_000036723.1.8711 WP_000036723.1.87147 WP_000036723.1.87177 WP_000036723.1.87189 WP_000036723.1.87199 WP_000036723.1.87205 WP_000036723.1.87247 WP_000036723.1.87249 WP_000036723.1.87254 WP_000036723.1.87310 WP_000036723.1.87339 WP_000036723.1.87358 WP_000036723.1.87371 WP_000036723.1.87382 WP_000036723.1.87389 WP_000036723.1.87400 WP_000036723.1.87410 WP_000036723.1.87443 WP_000036723.1.87465 WP_000036723.1.87491 WP_000036723.1.87504 WP_000036723.1.87557 WP_000036723.1.87563 WP_000036723.1.87568 WP_000036723.1.87574 WP_000036723.1.87581 WP_000036723.1.87590 WP_000036723.1.87607 WP_000036723.1.87610 WP_000036723.1.87616 WP_000036723.1.87633 WP_000036723.1.87635 WP_000036723.1.87639 WP_000036723.1.87655 WP_000036723.1.87675 WP_000036723.1.87694 WP_000036723.1.87696 WP_000036723.1.87721 WP_000036723.1.87726 WP_000036723.1.87728 WP_000036723.1.87733 WP_000036723.1.87738 WP_000036723.1.87766 WP_000036723.1.8778 WP_000036723.1.87788 WP_000036723.1.87789 WP_000036723.1.87822 WP_000036723.1.87834 WP_000036723.1.87857 WP_000036723.1.87883 WP_000036723.1.87914 WP_000036723.1.87919 WP_000036723.1.87973 WP_000036723.1.87976 WP_000036723.1.87980 WP_000036723.1.87989 WP_000036723.1.87990 WP_000036723.1.880 WP_000036723.1.88017 WP_000036723.1.88020 WP_000036723.1.8807 WP_000036723.1.88082 WP_000036723.1.88088 WP_000036723.1.88110 WP_000036723.1.88119 WP_000036723.1.88147 WP_000036723.1.88149 WP_000036723.1.88155 WP_000036723.1.88197 WP_000036723.1.8822 WP_000036723.1.88234 WP_000036723.1.88238 WP_000036723.1.88260 WP_000036723.1.88285 WP_000036723.1.88301 WP_000036723.1.88304 WP_000036723.1.88336 WP_000036723.1.88376 WP_000036723.1.88379 WP_000036723.1.88384 WP_000036723.1.88427 WP_000036723.1.8843 WP_000036723.1.88434 WP_000036723.1.88462 WP_000036723.1.88467 WP_000036723.1.8848 WP_000036723.1.88499 WP_000036723.1.88505 WP_000036723.1.88524 WP_000036723.1.88527 WP_000036723.1.88528 WP_000036723.1.88535 WP_000036723.1.88539 WP_000036723.1.8855 WP_000036723.1.88557 WP_000036723.1.88562 WP_000036723.1.88598 WP_000036723.1.88603 WP_000036723.1.88607 WP_000036723.1.88631 WP_000036723.1.88646 WP_000036723.1.88667 WP_000036723.1.88678 WP_000036723.1.88686 WP_000036723.1.88709 WP_000036723.1.88710 WP_000036723.1.88711 WP_000036723.1.88717 WP_000036723.1.88720 WP_000036723.1.88729 WP_000036723.1.8873 WP_000036723.1.88732 WP_000036723.1.88735 WP_000036723.1.88752 WP_000036723.1.88757 WP_000036723.1.88767 WP_000036723.1.8879 WP_000036723.1.88793 WP_000036723.1.88803 WP_000036723.1.88826 WP_000036723.1.88834 WP_000036723.1.88880 WP_000036723.1.88883 WP_000036723.1.88891 WP_000036723.1.88941 WP_000036723.1.88950 WP_000036723.1.88953 WP_000036723.1.88961 WP_000036723.1.88997 WP_000036723.1.89043 WP_000036723.1.89050 WP_000036723.1.8906 WP_000036723.1.89067 WP_000036723.1.89069 WP_000036723.1.89090 WP_000036723.1.89099 WP_000036723.1.89150 WP_000036723.1.89163 WP_000036723.1.89165 WP_000036723.1.89183 WP_000036723.1.89197 WP_000036723.1.89200 WP_000036723.1.89203 WP_000036723.1.89214 WP_000036723.1.89217 WP_000036723.1.89255 WP_000036723.1.8928 WP_000036723.1.89285 WP_000036723.1.89305 WP_000036723.1.89322 WP_000036723.1.89334 WP_000036723.1.89335 WP_000036723.1.89351 WP_000036723.1.89379 WP_000036723.1.8938 WP_000036723.1.89385 WP_000036723.1.89396 WP_000036723.1.894 WP_000036723.1.89400 WP_000036723.1.89405 WP_000036723.1.89416 WP_000036723.1.89427 WP_000036723.1.89432 WP_000036723.1.8945 WP_000036723.1.89455 WP_000036723.1.89458 WP_000036723.1.89466 WP_000036723.1.89468 WP_000036723.1.89469 WP_000036723.1.89471 WP_000036723.1.89474 WP_000036723.1.89479 WP_000036723.1.89492 WP_000036723.1.89496 WP_000036723.1.89551 WP_000036723.1.89569 WP_000036723.1.89583 WP_000036723.1.89601 WP_000036723.1.89627 WP_000036723.1.89630 WP_000036723.1.89631 WP_000036723.1.89646 WP_000036723.1.89656 WP_000036723.1.89674 WP_000036723.1.89679 WP_000036723.1.89700 WP_000036723.1.89745 WP_000036723.1.89747 WP_000036723.1.89768 WP_000036723.1.89781 WP_000036723.1.89788 WP_000036723.1.89818 WP_000036723.1.89839 WP_000036723.1.8985 WP_000036723.1.89852 WP_000036723.1.89859 WP_000036723.1.89879 WP_000036723.1.89895 WP_000036723.1.89899 WP_000036723.1.89915 WP_000036723.1.89917 WP_000036723.1.89918 WP_000036723.1.89920 WP_000036723.1.89923 WP_000036723.1.89927 WP_000036723.1.89977 WP_000036723.1.89988 WP_000036723.1.89998 WP_000036723.1.90017 WP_000036723.1.90022 WP_000036723.1.90050 WP_000036723.1.90063 WP_000036723.1.90065 WP_000036723.1.90078 WP_000036723.1.9009 WP_000036723.1.9010 WP_000036723.1.90115 WP_000036723.1.90139 WP_000036723.1.90146 WP_000036723.1.90168 WP_000036723.1.90171 WP_000036723.1.90182 WP_000036723.1.902 WP_000036723.1.90205 WP_000036723.1.90219 WP_000036723.1.90256 WP_000036723.1.90257 WP_000036723.1.90266 WP_000036723.1.90270 WP_000036723.1.90314 WP_000036723.1.90315 WP_000036723.1.90332 WP_000036723.1.90342 WP_000036723.1.90346 WP_000036723.1.90349 WP_000036723.1.90357 WP_000036723.1.90358 WP_000036723.1.9036 WP_000036723.1.9037 WP_000036723.1.90389 WP_000036723.1.90435 WP_000036723.1.90436 WP_000036723.1.90441 WP_000036723.1.90449 WP_000036723.1.90511 WP_000036723.1.90520 WP_000036723.1.90525 WP_000036723.1.90536 WP_000036723.1.90542 WP_000036723.1.90547 WP_000036723.1.9059 WP_000036723.1.90591 WP_000036723.1.90602 WP_000036723.1.9061 WP_000036723.1.90626 WP_000036723.1.90690 WP_000036723.1.90703 WP_000036723.1.90706 WP_000036723.1.90775 WP_000036723.1.90799 WP_000036723.1.9081 WP_000036723.1.90813 WP_000036723.1.90822 WP_000036723.1.90828 WP_000036723.1.90834 WP_000036723.1.90837 WP_000036723.1.90839 WP_000036723.1.90842 WP_000036723.1.90844 WP_000036723.1.90848 WP_000036723.1.90856 WP_000036723.1.90864 WP_000036723.1.90865 WP_000036723.1.9087 WP_000036723.1.90873 WP_000036723.1.90890 WP_000036723.1.909 WP_000036723.1.90905 WP_000036723.1.90924 WP_000036723.1.90951 WP_000036723.1.90960 WP_000036723.1.90967 WP_000036723.1.90979 WP_000036723.1.9098 WP_000036723.1.90988 WP_000036723.1.90996 WP_000036723.1.90997 WP_000036723.1.91 WP_000036723.1.91007 WP_000036723.1.91010 WP_000036723.1.91018 WP_000036723.1.9104 WP_000036723.1.91072 WP_000036723.1.91088 WP_000036723.1.91094 WP_000036723.1.91113 WP_000036723.1.91117 WP_000036723.1.91121 WP_000036723.1.91143 WP_000036723.1.91153 WP_000036723.1.91170 WP_000036723.1.91182 WP_000036723.1.9119 WP_000036723.1.91213 WP_000036723.1.91220 WP_000036723.1.91266 WP_000036723.1.91268 WP_000036723.1.91277 WP_000036723.1.91288 WP_000036723.1.91290 WP_000036723.1.91340 WP_000036723.1.91341 WP_000036723.1.91354 WP_000036723.1.91356 WP_000036723.1.91361 WP_000036723.1.91377 WP_000036723.1.91384 WP_000036723.1.91397 WP_000036723.1.91414 WP_000036723.1.91425 WP_000036723.1.91445 WP_000036723.1.91462 WP_000036723.1.91482 WP_000036723.1.91485 WP_000036723.1.91494 WP_000036723.1.915 WP_000036723.1.91511 WP_000036723.1.91515 WP_000036723.1.91516 WP_000036723.1.91543 WP_000036723.1.91548 WP_000036723.1.91549 WP_000036723.1.91551 WP_000036723.1.91565 WP_000036723.1.91566 WP_000036723.1.9157 WP_000036723.1.91594 WP_000036723.1.91596 WP_000036723.1.9160 WP_000036723.1.91626 WP_000036723.1.91640 WP_000036723.1.91643 WP_000036723.1.91644 WP_000036723.1.91651 WP_000036723.1.91666 WP_000036723.1.91672 WP_000036723.1.9168 WP_000036723.1.91685 WP_000036723.1.9169 WP_000036723.1.9171 WP_000036723.1.91739 WP_000036723.1.91756 WP_000036723.1.91777 WP_000036723.1.91779 WP_000036723.1.91782 WP_000036723.1.91787 WP_000036723.1.91801 WP_000036723.1.91814 WP_000036723.1.91843 WP_000036723.1.9185 WP_000036723.1.91850 WP_000036723.1.91863 WP_000036723.1.91871 WP_000036723.1.91879 WP_000036723.1.91887 WP_000036723.1.91893 WP_000036723.1.91894 WP_000036723.1.91951 WP_000036723.1.91954 WP_000036723.1.91959 WP_000036723.1.91965 WP_000036723.1.91971 WP_000036723.1.9199 WP_000036723.1.91994 WP_000036723.1.92005 WP_000036723.1.92014 WP_000036723.1.92019 WP_000036723.1.92025 WP_000036723.1.92031 WP_000036723.1.92048 WP_000036723.1.92053 WP_000036723.1.92058 WP_000036723.1.9209 WP_000036723.1.92096 WP_000036723.1.921 WP_000036723.1.92102 WP_000036723.1.92114 WP_000036723.1.92123 WP_000036723.1.9215 WP_000036723.1.92161 WP_000036723.1.92163 WP_000036723.1.92180 WP_000036723.1.92201 WP_000036723.1.92215 WP_000036723.1.92224 WP_000036723.1.92276 WP_000036723.1.92295 WP_000036723.1.92304 WP_000036723.1.92305 WP_000036723.1.92311 WP_000036723.1.92323 WP_000036723.1.92361 WP_000036723.1.92384 WP_000036723.1.92403 WP_000036723.1.92434 WP_000036723.1.92473 WP_000036723.1.92532 WP_000036723.1.9255 WP_000036723.1.92568 WP_000036723.1.92577 WP_000036723.1.92614 WP_000036723.1.92615 WP_000036723.1.92634 WP_000036723.1.92638 WP_000036723.1.9264 WP_000036723.1.92648 WP_000036723.1.9266 WP_000036723.1.92668 WP_000036723.1.92693 WP_000036723.1.92708 WP_000036723.1.92719 WP_000036723.1.92742 WP_000036723.1.92750 WP_000036723.1.92767 WP_000036723.1.92780 WP_000036723.1.92792 WP_000036723.1.92819 WP_000036723.1.92845 WP_000036723.1.92865 WP_000036723.1.92882 WP_000036723.1.92886 WP_000036723.1.92943 WP_000036723.1.92953 WP_000036723.1.92989 WP_000036723.1.93005 WP_000036723.1.93016 WP_000036723.1.93017 WP_000036723.1.93019 WP_000036723.1.93023 WP_000036723.1.93027 WP_000036723.1.93033 WP_000036723.1.93048 WP_000036723.1.93052 WP_000036723.1.93054 WP_000036723.1.93069 WP_000036723.1.93072 WP_000036723.1.93085 WP_000036723.1.93100 WP_000036723.1.93112 WP_000036723.1.93133 WP_000036723.1.93138 WP_000036723.1.93139 WP_000036723.1.93150 WP_000036723.1.93167 WP_000036723.1.93175 WP_000036723.1.93185 WP_000036723.1.93233 WP_000036723.1.93252 WP_000036723.1.9327 WP_000036723.1.93276 WP_000036723.1.93291 WP_000036723.1.93309 WP_000036723.1.9331 WP_000036723.1.93312 WP_000036723.1.93326 WP_000036723.1.93338 WP_000036723.1.93379 WP_000036723.1.93388 WP_000036723.1.934 WP_000036723.1.93427 WP_000036723.1.93428 WP_000036723.1.93431 WP_000036723.1.93453 WP_000036723.1.93461 WP_000036723.1.93463 WP_000036723.1.93464 WP_000036723.1.93531 WP_000036723.1.93533 WP_000036723.1.93552 WP_000036723.1.9356 WP_000036723.1.93601 WP_000036723.1.93605 WP_000036723.1.93621 WP_000036723.1.93626 WP_000036723.1.93629 WP_000036723.1.93630 WP_000036723.1.93634 WP_000036723.1.93637 WP_000036723.1.93639 WP_000036723.1.93652 WP_000036723.1.93665 WP_000036723.1.93670 WP_000036723.1.93673 WP_000036723.1.93679 WP_000036723.1.93694 WP_000036723.1.93695 WP_000036723.1.93716 WP_000036723.1.93733 WP_000036723.1.93737 WP_000036723.1.93743 WP_000036723.1.93745 WP_000036723.1.93755 WP_000036723.1.93765 WP_000036723.1.93768 WP_000036723.1.93800 WP_000036723.1.93821 WP_000036723.1.93870 WP_000036723.1.93873 WP_000036723.1.93877 WP_000036723.1.93911 WP_000036723.1.93918 WP_000036723.1.93922 WP_000036723.1.93939 WP_000036723.1.93951 WP_000036723.1.93952 WP_000036723.1.93971 WP_000036723.1.94008 WP_000036723.1.94011 WP_000036723.1.94025 WP_000036723.1.94028 WP_000036723.1.94035 WP_000036723.1.94040 WP_000036723.1.94057 WP_000036723.1.94069 WP_000036723.1.94156 WP_000036723.1.9416 WP_000036723.1.94176 WP_000036723.1.94187 WP_000036723.1.94190 WP_000036723.1.9420 WP_000036723.1.94213 WP_000036723.1.94232 WP_000036723.1.9426 WP_000036723.1.94271 WP_000036723.1.94282 WP_000036723.1.94298 WP_000036723.1.94302 WP_000036723.1.94317 WP_000036723.1.94343 WP_000036723.1.94353 WP_000036723.1.94367 WP_000036723.1.94388 WP_000036723.1.94404 WP_000036723.1.94417 WP_000036723.1.94430 WP_000036723.1.94436 WP_000036723.1.94438 WP_000036723.1.94445 WP_000036723.1.94446 WP_000036723.1.94468 WP_000036723.1.94475 WP_000036723.1.94507 WP_000036723.1.94542 WP_000036723.1.94544 WP_000036723.1.94548 WP_000036723.1.9457 WP_000036723.1.94578 WP_000036723.1.94580 WP_000036723.1.94589 WP_000036723.1.94619 WP_000036723.1.94626 WP_000036723.1.94646 WP_000036723.1.94653 WP_000036723.1.94676 WP_000036723.1.94686 WP_000036723.1.94692 WP_000036723.1.94695 WP_000036723.1.94704 WP_000036723.1.94738 WP_000036723.1.94739 WP_000036723.1.9474 WP_000036723.1.94754 WP_000036723.1.94787 WP_000036723.1.94790 WP_000036723.1.948 WP_000036723.1.94808 WP_000036723.1.94822 WP_000036723.1.94823 WP_000036723.1.94836 WP_000036723.1.94841 WP_000036723.1.94847 WP_000036723.1.94869 WP_000036723.1.94880 WP_000036723.1.94889 WP_000036723.1.9489 WP_000036723.1.94892 WP_000036723.1.94898 WP_000036723.1.949 WP_000036723.1.94903 WP_000036723.1.94907 WP_000036723.1.9491 WP_000036723.1.94927 WP_000036723.1.94934 WP_000036723.1.94935 WP_000036723.1.94938 WP_000036723.1.94949 WP_000036723.1.94955 WP_000036723.1.94991 WP_000036723.1.94993 WP_000036723.1.94997 WP_000036723.1.95005 WP_000036723.1.95011 WP_000036723.1.95022 WP_000036723.1.95028 WP_000036723.1.95035 WP_000036723.1.95037 WP_000036723.1.95062 WP_000036723.1.95080 WP_000036723.1.95084 WP_000036723.1.95105 WP_000036723.1.95129 WP_000036723.1.9513 WP_000036723.1.95161 WP_000036723.1.95198 WP_000036723.1.95243 WP_000036723.1.95244 WP_000036723.1.95254 WP_000036723.1.95275 WP_000036723.1.95310 WP_000036723.1.95329 WP_000036723.1.95332 WP_000036723.1.95364 WP_000036723.1.95366 WP_000036723.1.95368 WP_000036723.1.95378 WP_000036723.1.95381 WP_000036723.1.95390 WP_000036723.1.95395 WP_000036723.1.95398 WP_000036723.1.95400 WP_000036723.1.95424 WP_000036723.1.95428 WP_000036723.1.95438 WP_000036723.1.95449 WP_000036723.1.95490 WP_000036723.1.95518 WP_000036723.1.95521 WP_000036723.1.95563 WP_000036723.1.9559 WP_000036723.1.95595 WP_000036723.1.95596 WP_000036723.1.95604 WP_000036723.1.95611 WP_000036723.1.95628 WP_000036723.1.95634 WP_000036723.1.95655 WP_000036723.1.9566 WP_000036723.1.95666 WP_000036723.1.95680 WP_000036723.1.95712 WP_000036723.1.95771 WP_000036723.1.95783 WP_000036723.1.95784 WP_000036723.1.95800 WP_000036723.1.95801 WP_000036723.1.95824 WP_000036723.1.95827 WP_000036723.1.95834 WP_000036723.1.95846 WP_000036723.1.95849 WP_000036723.1.95858 WP_000036723.1.95861 WP_000036723.1.95865 WP_000036723.1.95916 WP_000036723.1.95919 WP_000036723.1.95929 WP_000036723.1.95931 WP_000036723.1.95932 WP_000036723.1.95951 WP_000036723.1.960 WP_000036723.1.96015 WP_000036723.1.96053 WP_000036723.1.96059 WP_000036723.1.96066 WP_000036723.1.96086 WP_000036723.1.96097 WP_000036723.1.96110 WP_000036723.1.96114 WP_000036723.1.96128 WP_000036723.1.96143 WP_000036723.1.96145 WP_000036723.1.9616 WP_000036723.1.96177 WP_000036723.1.96215 WP_000036723.1.96222 WP_000036723.1.96223 WP_000036723.1.96229 WP_000036723.1.96247 WP_000036723.1.96253 WP_000036723.1.96263 WP_000036723.1.96278 WP_000036723.1.96279 WP_000036723.1.96281 WP_000036723.1.96290 WP_000036723.1.96299 WP_000036723.1.96303 WP_000036723.1.9631 WP_000036723.1.96339 WP_000036723.1.96341 WP_000036723.1.96378 WP_000036723.1.96392 WP_000036723.1.96394 WP_000036723.1.9641 WP_000036723.1.96417 WP_000036723.1.96425 WP_000036723.1.96450 WP_000036723.1.96457 WP_000036723.1.96478 WP_000036723.1.96479 WP_000036723.1.96480 WP_000036723.1.96484 WP_000036723.1.9649 WP_000036723.1.96494 WP_000036723.1.965 WP_000036723.1.96519 WP_000036723.1.96541 WP_000036723.1.96558 WP_000036723.1.96562 WP_000036723.1.9657 WP_000036723.1.96585 WP_000036723.1.96608 WP_000036723.1.96609 WP_000036723.1.9661 WP_000036723.1.96617 WP_000036723.1.96633 WP_000036723.1.96650 WP_000036723.1.96676 WP_000036723.1.9668 WP_000036723.1.96680 WP_000036723.1.96695 WP_000036723.1.9671 WP_000036723.1.96725 WP_000036723.1.96743 WP_000036723.1.96759 WP_000036723.1.96762 WP_000036723.1.96769 WP_000036723.1.96796 WP_000036723.1.96797 WP_000036723.1.96817 WP_000036723.1.9682 WP_000036723.1.96820 WP_000036723.1.96850 WP_000036723.1.96864 WP_000036723.1.96894 WP_000036723.1.9690 WP_000036723.1.96907 WP_000036723.1.9691 WP_000036723.1.96924 WP_000036723.1.96932 WP_000036723.1.96936 WP_000036723.1.96944 WP_000036723.1.96971 WP_000036723.1.96984 WP_000036723.1.96989 WP_000036723.1.97011 WP_000036723.1.97027 WP_000036723.1.97049 WP_000036723.1.97059 WP_000036723.1.97119 WP_000036723.1.97123 WP_000036723.1.97147 WP_000036723.1.97160 WP_000036723.1.97170 WP_000036723.1.97193 WP_000036723.1.97200 WP_000036723.1.97226 WP_000036723.1.9723 WP_000036723.1.97231 WP_000036723.1.97238 WP_000036723.1.97247 WP_000036723.1.97248 WP_000036723.1.97269 WP_000036723.1.97279 WP_000036723.1.97282 WP_000036723.1.9729 WP_000036723.1.97292 WP_000036723.1.97344 WP_000036723.1.97351 WP_000036723.1.97356 WP_000036723.1.97360 WP_000036723.1.97361 WP_000036723.1.97379 WP_000036723.1.97387 WP_000036723.1.9740 WP_000036723.1.97402 WP_000036723.1.97418 WP_000036723.1.97421 WP_000036723.1.97434 WP_000036723.1.97437 WP_000036723.1.97439 WP_000036723.1.97459 WP_000036723.1.97464 WP_000036723.1.9747 WP_000036723.1.97490 WP_000036723.1.97502 WP_000036723.1.97513 WP_000036723.1.97538 WP_000036723.1.97544 WP_000036723.1.97549 WP_000036723.1.97560 WP_000036723.1.97571 WP_000036723.1.97619 WP_000036723.1.97632 WP_000036723.1.97654 WP_000036723.1.97667 WP_000036723.1.97677 WP_000036723.1.97685 WP_000036723.1.9770 WP_000036723.1.97705 WP_000036723.1.97770 WP_000036723.1.97778 WP_000036723.1.97789 WP_000036723.1.97798 WP_000036723.1.978 WP_000036723.1.97815 WP_000036723.1.97822 WP_000036723.1.97823 WP_000036723.1.97825 WP_000036723.1.97871 WP_000036723.1.97890 WP_000036723.1.97919 WP_000036723.1.97930 WP_000036723.1.97932 WP_000036723.1.97937 WP_000036723.1.97962 WP_000036723.1.97982 WP_000036723.1.97996 WP_000036723.1.98000 WP_000036723.1.98005 WP_000036723.1.98012 WP_000036723.1.98026 WP_000036723.1.9803 WP_000036723.1.98046 WP_000036723.1.98082 WP_000036723.1.98083 WP_000036723.1.981 WP_000036723.1.98102 WP_000036723.1.98115 WP_000036723.1.98139 WP_000036723.1.98155 WP_000036723.1.9816 WP_000036723.1.98167 WP_000036723.1.9817 WP_000036723.1.98176 WP_000036723.1.98187 WP_000036723.1.98202 WP_000036723.1.98205 WP_000036723.1.98232 WP_000036723.1.98235 WP_000036723.1.98239 WP_000036723.1.98241 WP_000036723.1.98244 WP_000036723.1.98251 WP_000036723.1.98279 WP_000036723.1.98292 WP_000036723.1.98294 WP_000036723.1.98301 WP_000036723.1.98312 WP_000036723.1.98323 WP_000036723.1.98355 WP_000036723.1.98357 WP_000036723.1.98384 WP_000036723.1.98400 WP_000036723.1.98404 WP_000036723.1.98424 WP_000036723.1.98429 WP_000036723.1.9844 WP_000036723.1.98442 WP_000036723.1.98451 WP_000036723.1.98466 WP_000036723.1.98480 WP_000036723.1.98484 WP_000036723.1.98543 WP_000036723.1.98549 WP_000036723.1.98569 WP_000036723.1.98578 WP_000036723.1.9858 WP_000036723.1.98614 WP_000036723.1.98626 WP_000036723.1.98628 WP_000036723.1.98633 WP_000036723.1.9864 WP_000036723.1.98654 WP_000036723.1.98665 WP_000036723.1.98668 WP_000036723.1.98683 WP_000036723.1.98702 WP_000036723.1.98727 WP_000036723.1.98757 WP_000036723.1.98775 WP_000036723.1.98776 WP_000036723.1.98784 WP_000036723.1.98795 WP_000036723.1.9883 WP_000036723.1.98849 WP_000036723.1.98875 WP_000036723.1.98920 WP_000036723.1.98976 WP_000036723.1.98988 WP_000036723.1.99006 WP_000036723.1.99029 WP_000036723.1.99046 WP_000036723.1.99060 WP_000036723.1.99101 WP_000036723.1.99119 WP_000036723.1.99168 WP_000036723.1.99182 WP_000036723.1.99209 WP_000036723.1.99234 WP_000036723.1.99246 WP_000036723.1.99265 WP_000036723.1.99289 WP_000036723.1.99292 WP_000036723.1.99295 WP_000036723.1.99302 WP_000036723.1.99304 WP_000036723.1.99306 WP_000036723.1.99307 WP_000036723.1.99310 WP_000036723.1.99319 WP_000036723.1.99334 WP_000036723.1.99345 WP_000036723.1.99349 WP_000036723.1.9935 WP_000036723.1.99361 WP_000036723.1.99366 WP_000036723.1.99392 WP_000036723.1.9940 WP_000036723.1.99400 WP_000036723.1.99401 WP_000036723.1.99446 WP_000036723.1.99453 WP_000036723.1.99458 WP_000036723.1.99471 WP_000036723.1.99472 WP_000036723.1.99475 WP_000036723.1.99486 WP_000036723.1.99487 WP_000036723.1.99498 WP_000036723.1.9950 WP_000036723.1.99501 WP_000036723.1.99511 WP_000036723.1.99534 WP_000036723.1.99549 WP_000036723.1.99562 WP_000036723.1.99571 WP_000036723.1.99592 WP_000036723.1.99602 WP_000036723.1.99603 WP_000036723.1.99619 WP_000036723.1.99632 WP_000036723.1.99666 WP_000036723.1.99692 WP_000036723.1.99694 WP_000036723.1.99698 WP_000036723.1.99734 WP_000036723.1.99771 WP_000036723.1.99782 WP_000036723.1.99804 WP_000036723.1.99827 WP_000036723.1.99869 WP_000036723.1.99874 WP_000036723.1.99891 WP_000036723.1.99892 WP_000036723.1.99929 WP_000036723.1.99986 YP_002409124.1.10275 YP_002413796.1.14968 YP_006121067.1.29421 YP_006777835.1.12065 YP_404510.1.10455 gi|218706277|ref|YP_002413796.1| gi|251786053|ref|YP_003000357.1| gi|556552692|ref|YP_008723037.1| gi|30064126|ref|NP_838297.1| gi|15832893|ref|NP_311666.1| gi|209400352|ref|YP_002272244.1| gi|209920228|ref|YP_002294312.1| gi|386710636|ref|YP_006174357.1| gi|16130686|ref|NP_417259.1| gi|253772370|ref|YP_003035201.1| gi|386600770|ref|YP_006102276.1| gi|387622462|ref|YP_006130090.1| gi|386625496|ref|YP_006145224.1| gi|384544355|ref|YP_005728418.1| gi|218701495|ref|YP_002409124.1| gi|157162233|ref|YP_001459551.1| gi|407470653|ref|YP_006782904.1| gi|387508135|ref|YP_006160391.1| gi|260845425|ref|YP_003223203.1| gi|386710636|ref|YP_006174357.1| gi|544391295|ref|YP_008565895.1| gi|410481252|ref|YP_006768798.1| gi|24114065|ref|NP_708575.1| gi|388478795|ref|YP_490987.1| gi|387618045|ref|YP_006121067.1| gi|378711795|ref|YP_005276688.1| gi|91212145|ref|YP_542131.1| gi|386630516|ref|YP_006150236.1| gi|222157465|ref|YP_002557604.1| gi|218547705|ref|YP_002381496.1| gi|215488096|ref|YP_002330527.1| gi|238901915|ref|YP_002927711.1| gi|260869458|ref|YP_003235860.1| gi|407480686|ref|YP_006777835.1| gi|254162705|ref|YP_003045813.1| 198214.SF2794 198215.S2988 199310.c3344 300267.SDY_2996 300268.SBO_2660 316385.ECDH10B_2946 316407.eno 331111.EcE24377A_3083 331112.EcHS_A2923 344609.SbBS512_E3094 362663.ECP_2760 364106.UTI89_C3148 386585.ECs3639 405955.APECO1_3751 409438.ECSE_3037 413997.ECB_02624 439855.EcSMS35_2917 444450.ECH74115_4039 469008.ECBD_0950 481805.EcolC_0933 511145.b2779 544404.ECSP_3731 573235.ECO26_3849 574521.E2348C_3046 585034.ECIAI1_2887 585035.ECS88_3047 585054.EFER_0285 585055.EC55989_3054 585056.ECUMN_3110 585057.ECIAI39_3198 585395.ECO103_3322 585396.ECO111_3503 585397.ECED1_3232 595496.BWG_2514 gi|383179942|ref|YP_005457947.1| gi|387883959|ref|YP_006314261.1| gi|386706039|ref|YP_006169886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]