SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_0857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203119.Cthe_0857
Domain Number 1 Region: 101-162
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000549
Family NfeD domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_0857
Sequence length 163
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MFDFVHNIDIWAAISFILGFIFVIIEMFFPGFGLPGVVGLIFLFIGIVLTAKTLTDVLVL
LAIILLILAVVLAIAVRSASKGRLKKLVLTDSLEKESGFEGTEDFTSFLGKEGVALTALR
PAGTAEFDGVKLDVVSEFDFIEKDAKVKIVKVEGRRIVVRKID
Download sequence
Identical sequences A3DDR2
WP_003517163.1.16390 WP_003517163.1.19387 WP_003517163.1.20586 WP_003517163.1.31213 WP_003517163.1.55520 WP_003517163.1.60145 WP_003517163.1.6636 WP_003517163.1.6965 gi|385778712|ref|YP_005687877.1| 203119.Cthe_0857 gi|125973374|ref|YP_001037284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]