SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203119.Cthe_2481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  203119.Cthe_2481
Domain Number - Region: 42-88
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00915
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 203119.Cthe_2481
Sequence length 111
Comment (Clostridium thermocellum ATCC 27405)
Sequence
MSVLQRLWKDRMDIYRWVEVVEGGFTKQKKEKIYENVKCHYSKGQLVNTGEDSVPTLITS
HTLFCGPDVDLQEGDEVVVTQRNGKQVTLTVGEGFPYSTHQEFSVKRVDTA
Download sequence
Identical sequences A3DIA4
WP_020457826.1.31213 203119.Cthe_2481 gi|125974966|ref|YP_001038876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]