SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_0311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_0311
Domain Number 1 Region: 58-161
Classification Level Classification E-value
Superfamily Acid proteases 1.48e-19
Family Pepsin-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_0311
Sequence length 174
Comment (Saccharophagus degradans 2-40)
Sequence
MEENQQAPEQRIGRGMLMIGWVLAIVVATLLIQRWQDKRHNPNAMPESSSANGVNQVVLQ
RNPQHHYLTDGTINNKPVTFLLDTGATDVAIPSALAKKLGLKRGAKGAAHTANGVTTTYR
TNIDVLKLGSITLYDVDASITMGFTGDEILLGMSALKSVEFTHRNGTLVLKQYY
Download sequence
Identical sequences Q21P04
203122.Sde_0311 WP_011466799.1.82451 gi|90019960|ref|YP_525787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]