SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 203122.Sde_2180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  203122.Sde_2180
Domain Number 1 Region: 33-128
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 203122.Sde_2180
Sequence length 129
Comment (Saccharophagus degradans 2-40)
Sequence
MLKSNGIVERVCPKRQEITCLFSREISMPISSSVSSDGGTLTITVNGRFDATLLDEFRRS
YEDIAGPAVKNYTVDLGKTEHLDSSALGMLLVLRDYAGGDKAAITITNCSPEVKKIFSIS
SFEQLFKIQ
Download sequence
Identical sequences Q21IN9
203122.Sde_2180 gi|90021825|ref|YP_527652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]